BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060850.seq (683 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0825 + 20831170-20831349,20831380-20831547,20831627-208316... 28 7.9 >10_08_0825 + 20831170-20831349,20831380-20831547,20831627-20831698, 20831997-20832075,20832182-20832375,20832469-20832558, 20832851-20832940,20833196-20833282,20833477-20833560, 20833690-20833809,20834096-20834103,20834443-20834575, 20835044-20835125,20835330-20835496,20836006-20836493, 20836551-20836638,20836716-20836818,20836932-20837083, 20837191-20837316,20837459-20837529,20837691-20837753, 20838418-20838490,20838972-20839040,20839180-20839257, 20839434-20839484,20839586-20839696 Length = 1008 Score = 27.9 bits (59), Expect = 7.9 Identities = 17/61 (27%), Positives = 26/61 (42%), Gaps = 3/61 (4%) Frame = -2 Query: 571 LPACXLTLTSSLNCARGLPQHAXHCLPVSSRSLQT--GSNPNGLTI-HFDTQIFNXSVNP 401 +PA ++ GLP H LP +S L + GSNP G + + F +P Sbjct: 61 VPARAAAAAAAARAIAGLPPHEKISLPSNSEDLVSIYGSNPQGHAVDELEEVFFQEEFDP 120 Query: 400 V 398 + Sbjct: 121 I 121 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,303,053 Number of Sequences: 37544 Number of extensions: 212373 Number of successful extensions: 372 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 370 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 372 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1733104716 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -