BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060845.seq (685 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 24 5.1 AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 pr... 24 5.1 AY553322-1|AAT36323.1| 426|Anopheles gambiae G-protein coupled ... 23 9.0 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.8 bits (49), Expect = 5.1 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -3 Query: 632 STFCWLWHIGFYVTCSFLFCLXNLHVVLETNLWYFMDR 519 S + + I FYV CSFL + NL V + + + ++ R Sbjct: 1398 SNIAFPYFISFYVLCSFL--IINLFVAVIMDNFDYLTR 1433 >AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 protein. Length = 507 Score = 23.8 bits (49), Expect = 5.1 Identities = 10/39 (25%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = -3 Query: 482 IKQRLS-ALVHGRILSFFGHISRRGNDFIKCLDNICPQQ 369 ++Q+L+ GR+ FG I + +F+K ++ C ++ Sbjct: 133 LRQKLTPTFTSGRMKQMFGTIQQVAGEFLKYMNEHCHRE 171 >AY553322-1|AAT36323.1| 426|Anopheles gambiae G-protein coupled receptor 4 protein. Length = 426 Score = 23.0 bits (47), Expect = 9.0 Identities = 5/9 (55%), Positives = 8/9 (88%) Frame = -1 Query: 574 VXVIFMWCW 548 + V+F+WCW Sbjct: 312 IVVVFVWCW 320 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 660,124 Number of Sequences: 2352 Number of extensions: 11955 Number of successful extensions: 13 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68995575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -