BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060845.seq (685 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 25 0.67 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 24 1.2 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 22 4.7 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 25.0 bits (52), Expect = 0.67 Identities = 11/29 (37%), Positives = 14/29 (48%), Gaps = 2/29 (6%) Frame = -3 Query: 203 HPNFTIKKKYKRYNLDRNHFN--YNQQCK 123 H N K Y N + N++N YN CK Sbjct: 324 HNNNNYKYNYNNNNYNNNNYNNNYNNNCK 352 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -3 Query: 200 PNFTIKKKYKRYNLDRNHFNYNQQCKLTKVN 108 P T + Y RY + ++ NYN + K T ++ Sbjct: 168 PRATDSRHYDRYKEEESNENYNWEHKETHID 198 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 22.2 bits (45), Expect = 4.7 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = -3 Query: 488 LDIKQRLSALVHGRILSFFGHISR 417 +D+K L LV G I+ HI R Sbjct: 310 MDLKGDLEGLVEGVIIDCSNHIGR 333 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,533 Number of Sequences: 438 Number of extensions: 3545 Number of successful extensions: 24 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20830365 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -