BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060836.seq (693 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 25 0.90 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 23 2.1 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 24.6 bits (51), Expect = 0.90 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = -2 Query: 494 LFNRILXIVVIKLIAPIIDEIPAKCSEKI 408 +FN IL ++I +A ++ +P++ EK+ Sbjct: 217 VFNLILPCILINSVALLVFYVPSESGEKV 245 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 23.4 bits (48), Expect = 2.1 Identities = 10/39 (25%), Positives = 20/39 (51%) Frame = -2 Query: 488 NRILXIVVIKLIAPIIDEIPAKCSEKIARSTDLPLCAIL 372 N IL V+I + ++ +PA+ EK+ + L ++ Sbjct: 239 NLILPTVLISFLCVLVFYLPAEAGEKVTLGISILLSLVV 277 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,437 Number of Sequences: 438 Number of extensions: 2941 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21195810 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -