BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060835.seq (685 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC039252-1|AAH39252.2| 229|Homo sapiens FLJ20433 protein protein. 30 8.8 >BC039252-1|AAH39252.2| 229|Homo sapiens FLJ20433 protein protein. Length = 229 Score = 29.9 bits (64), Expect = 8.8 Identities = 17/44 (38%), Positives = 24/44 (54%) Frame = +1 Query: 283 LMELYNPASERHHQTPLFSIALIKEPTSPHKFPCSSFTLLDFLV 414 L+E P RH TP S+AL TSPH F C++ + ++V Sbjct: 132 LLEQTQPPQNRH-STPWNSLALPGMATSPHPF-CAALGICPYMV 173 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 114,219,598 Number of Sequences: 237096 Number of extensions: 2526151 Number of successful extensions: 5245 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 5009 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5245 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7783251346 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -