BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060834.seq (686 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ697727-1|CAG26920.1| 285|Anopheles gambiae putative odorant-b... 28 0.32 CR954257-10|CAJ14161.1| 519|Anopheles gambiae Sply, Sphingosine... 27 0.42 AJ549085-1|CAD70159.1| 529|Anopheles gambiae thioredoxin-disulf... 25 1.7 AJ549084-1|CAD70158.1| 505|Anopheles gambiae thioredoxin-disulf... 25 1.7 AJ459821-1|CAD30858.1| 502|Anopheles gambiae thioredoxin reduct... 25 1.7 AY496420-1|AAS80137.1| 447|Anopheles gambiae bacteria responsiv... 25 3.0 >AJ697727-1|CAG26920.1| 285|Anopheles gambiae putative odorant-binding protein OBPjj17 protein. Length = 285 Score = 27.9 bits (59), Expect = 0.32 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = -3 Query: 441 SLHSVRSSHSRAIRTKSSSEWVLI 370 SLH VR+S + I +SSS W+++ Sbjct: 2 SLHFVRTSTTHGINMRSSSVWLIV 25 >CR954257-10|CAJ14161.1| 519|Anopheles gambiae Sply, Sphingosine-phosphate lyase protein. Length = 519 Score = 27.5 bits (58), Expect = 0.42 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = -2 Query: 316 GVLVDDQTVQDLGRQTNIPH*ISKCIAVFVIPYL 215 G + D + + LGR+ NIP + C+ F+I ++ Sbjct: 253 GTMDDIEAIAALGRKYNIPVHVDACLGGFLIVFM 286 >AJ549085-1|CAD70159.1| 529|Anopheles gambiae thioredoxin-disulfide reductase protein. Length = 529 Score = 25.4 bits (53), Expect = 1.7 Identities = 15/48 (31%), Positives = 23/48 (47%) Frame = -2 Query: 400 DQILFRMGFDWVKAQTLVLVLVQT*SSEGVLVDDQTVQDLGRQTNIPH 257 D +LF +G + TL L ++EG D V + +TN+PH Sbjct: 312 DTVLFAIGRQ-AETGTLKLANAGVVTAEGGKSDKLEVDETDHRTNVPH 358 >AJ549084-1|CAD70158.1| 505|Anopheles gambiae thioredoxin-disulfide reductase protein. Length = 505 Score = 25.4 bits (53), Expect = 1.7 Identities = 15/48 (31%), Positives = 23/48 (47%) Frame = -2 Query: 400 DQILFRMGFDWVKAQTLVLVLVQT*SSEGVLVDDQTVQDLGRQTNIPH 257 D +LF +G + TL L ++EG D V + +TN+PH Sbjct: 288 DTVLFAIGRQ-AETGTLKLANAGVVTAEGGKSDKLEVDETDHRTNVPH 334 >AJ459821-1|CAD30858.1| 502|Anopheles gambiae thioredoxin reductase protein. Length = 502 Score = 25.4 bits (53), Expect = 1.7 Identities = 15/48 (31%), Positives = 23/48 (47%) Frame = -2 Query: 400 DQILFRMGFDWVKAQTLVLVLVQT*SSEGVLVDDQTVQDLGRQTNIPH 257 D +LF +G + TL L ++EG D V + +TN+PH Sbjct: 285 DTVLFAIGRQ-AETGTLKLANAGVVTAEGGKSDKLEVDETDHRTNVPH 331 >AY496420-1|AAS80137.1| 447|Anopheles gambiae bacteria responsive protein 1 protein. Length = 447 Score = 24.6 bits (51), Expect = 3.0 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +3 Query: 357 WAFTQSKPIRKRIWSG 404 W F Q+KP R R W+G Sbjct: 162 WQFPQTKPKRIRGWTG 177 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 700,671 Number of Sequences: 2352 Number of extensions: 14406 Number of successful extensions: 27 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -