BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060830.seq (686 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC63.05 |||TAP42 family protein |Schizosaccharomyces pombe|chr... 26 4.4 SPBC577.13 |syj2||inositol-polyphosphate 5-phosphatase |Schizosa... 26 4.4 >SPCC63.05 |||TAP42 family protein |Schizosaccharomyces pombe|chr 3|||Manual Length = 323 Score = 26.2 bits (55), Expect = 4.4 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +3 Query: 174 KRDQDSTDDFEHLDRETKQD 233 K D D DD+E LD +T +D Sbjct: 282 KSDSDDEDDYEKLDAKTMKD 301 >SPBC577.13 |syj2||inositol-polyphosphate 5-phosphatase |Schizosaccharomyces pombe|chr 2|||Manual Length = 889 Score = 26.2 bits (55), Expect = 4.4 Identities = 15/53 (28%), Positives = 28/53 (52%) Frame = +1 Query: 196 MISSISIVKLNKTRRIHRYTSSRGHSEFLGDGTWARSGTSAAFRRRKAYGPHG 354 +++S K + T RI+ Y S ++ L DG++ S + F R ++ P+G Sbjct: 147 LVNSEYSSKYSSTTRIYPYHSLSQLTDLLTDGSFYVSTNISCFSRFQSEQPYG 199 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,241,766 Number of Sequences: 5004 Number of extensions: 40581 Number of successful extensions: 111 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 108 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 111 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 317927284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -