BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060830.seq (686 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 23 2.1 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 2.1 AY588474-1|AAT94401.1| 104|Apis mellifera defensin 2 protein. 21 8.3 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 23.4 bits (48), Expect = 2.1 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +2 Query: 245 TGTHHRVATQSFLEMERGPAAEHRPPSVAE 334 T T + V Q+F ++ GP +E R AE Sbjct: 1049 TYTQYSVVVQAFNKVGSGPMSEERRQHTAE 1078 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 23.4 bits (48), Expect = 2.1 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +3 Query: 177 RDQDSTDDFEHLDRETKQ 230 RD+DST D LDR +++ Sbjct: 1409 RDEDSTRDSTKLDRSSRE 1426 >AY588474-1|AAT94401.1| 104|Apis mellifera defensin 2 protein. Length = 104 Score = 21.4 bits (43), Expect = 8.3 Identities = 16/44 (36%), Positives = 19/44 (43%) Frame = +3 Query: 429 SNSRSLALRHRNHRCLKLTTRHRCWPPARSACPRETCGAQSGAG 560 SN L LRHR C L+ + + SAC C AQ G Sbjct: 50 SNEPLLPLRHRRVTCDVLSWQSKWLSINHSACAIR-CLAQRRKG 92 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,387 Number of Sequences: 438 Number of extensions: 3124 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20952180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -