BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060828.seq (693 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 36 0.001 Z81291-1|CAB03592.1| 209|Anopheles gambiae GSTD1-5 protein prot... 26 0.98 AF071160-3|AAC79993.1| 209|Anopheles gambiae glutathione S-tran... 26 0.98 AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. 25 2.3 AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein pr... 25 2.3 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 23 6.9 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 35.9 bits (79), Expect = 0.001 Identities = 21/70 (30%), Positives = 32/70 (45%) Frame = +1 Query: 361 EVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMLERI*LAYPKR 540 +V VSG + ++ FE + + V V+ Y +PTPIQ PI + R +A + Sbjct: 161 QVRVSGENPPDHVESFERSGLREEVMTNVRKSSYTKPTPIQRYAIPIILNGRDLMACAQT 220 Query: 541 VPGKNVGLHL 570 GK L Sbjct: 221 GSGKTAAFML 230 >Z81291-1|CAB03592.1| 209|Anopheles gambiae GSTD1-5 protein protein. Length = 209 Score = 26.2 bits (55), Expect = 0.98 Identities = 14/50 (28%), Positives = 24/50 (48%) Frame = -3 Query: 691 ICSKLAEFGGANSLVXAKDPSNRTITSXNRRLVIYVHNCWQDVGQRFCPE 542 IC+ LAE G + + KDP R + N+R+ + +Q + P+ Sbjct: 68 ICTYLAEKYGKDDKLYPKDPQKRAVV--NQRMYFDMGTLYQRFADYYYPQ 115 >AF071160-3|AAC79993.1| 209|Anopheles gambiae glutathione S-transferase protein. Length = 209 Score = 26.2 bits (55), Expect = 0.98 Identities = 14/50 (28%), Positives = 24/50 (48%) Frame = -3 Query: 691 ICSKLAEFGGANSLVXAKDPSNRTITSXNRRLVIYVHNCWQDVGQRFCPE 542 IC+ LAE G + + KDP R + N+R+ + +Q + P+ Sbjct: 68 ICTYLAEKYGKDDKLYPKDPQKRAVV--NQRMYFDMGTLYQRFADYYYPQ 115 >AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. Length = 471 Score = 25.0 bits (52), Expect = 2.3 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = -3 Query: 163 RRIIAEFVASSKFGTTVSTAIIPVTRHDYFSDLVEDVYLNYGFFLTQ 23 RR+ A+ A ++F ++ YF D+V DV L Y + Q Sbjct: 59 RRVRAKSKAMTEFLPLCDVLFNVISLAGYFCDVVFDVVLGYALYERQ 105 >AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein protein. Length = 476 Score = 25.0 bits (52), Expect = 2.3 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 6/38 (15%) Frame = -2 Query: 236 ALQRILFSHQSLQILQ------IYCHRCQTETNYRRIC 141 A +R+ SHQS IL+ I CHRC+ + +R C Sbjct: 180 AQKRMEKSHQSESILRVGPEKKITCHRCRKPGHMKRDC 217 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 23.4 bits (48), Expect = 6.9 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +1 Query: 313 VLKRSPYEVEEYRNKHEVTVSGVEVHNPIQY 405 V++R P V+ + H+V V VH P+ + Sbjct: 139 VVRREPSAVKIAQPVHKVIAQPVHVHAPVAH 169 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 692,352 Number of Sequences: 2352 Number of extensions: 14207 Number of successful extensions: 28 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70250040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -