BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060823.seq (678 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0138 + 17093196-17093325,17095704-17095804,17096224-170962... 37 0.017 07_01_0479 + 3606663-3607448 36 0.023 07_03_1067 + 23728642-23728690,23728832-23729010 36 0.030 03_01_0164 - 1326002-1326409,1326410-1326428,1326523-1326647,132... 36 0.030 01_02_0007 + 10132380-10133201 35 0.069 04_03_0742 + 19200045-19200053,19200158-19200437,19201331-192015... 33 0.21 09_01_0165 - 2436769-2437442,2438159-2438224,2438318-2438415,243... 33 0.28 09_04_0684 - 19442335-19442990,19443774-19443839,19443935-194440... 32 0.49 09_01_0079 - 1159963-1160211,1160303-1160509,1160631-1160801,116... 32 0.49 08_01_0178 - 1509100-1511214 32 0.49 05_05_0173 + 22956927-22958615 32 0.49 05_01_0142 - 940421-940701,941262-941574 32 0.49 03_06_0471 + 34169562-34169892,34170121-34170347 32 0.49 11_06_0610 - 25449085-25453284 31 0.64 02_02_0119 + 6978697-6979045,6979519-6979581,6979757-6979866,697... 31 0.85 04_04_0435 - 25170348-25170593,25170989-25171189,25171580-251717... 31 1.1 04_01_0453 + 5869627-5870232,5870383-5870897,5870964-5871600 31 1.1 12_02_1174 - 26696869-26698191 30 1.5 07_03_1160 - 24430240-24431268 30 1.5 02_05_0970 - 33179180-33179210,33179297-33179441,33180307-331803... 30 1.5 02_05_0700 + 31018480-31019832 30 1.5 08_02_1403 + 26811020-26811146,26813351-26813609,26814932-26814983 30 2.0 08_02_0163 + 13470178-13470335,13470635-13470656,13470885-134710... 30 2.0 04_03_0711 + 18945012-18945692,18945790-18946845,18946863-18947066 30 2.0 01_07_0188 - 41866689-41866763,41866889-41867155,41867277-418677... 29 2.6 01_06_1805 - 39999987-40000169,40000648-40000974,40001724-400020... 29 2.6 12_02_0046 + 12830974-12832386 29 3.4 09_04_0506 - 18188785-18190599 29 3.4 09_04_0424 + 17444261-17444665,17445974-17446367,17447367-174474... 29 3.4 07_03_1546 + 27602598-27602917,27602995-27603052,27603130-276032... 29 3.4 07_03_1315 - 25722757-25722876,25722972-25723328,25723924-257245... 29 3.4 01_01_0907 + 7128397-7128497,7129944-7130022,7130470-7130568,713... 29 3.4 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 29 4.5 05_01_0492 - 4102379-4103494,4104105-4104383,4105395-4105724 29 4.5 04_03_0689 + 18746735-18748296,18748401-18748485 29 4.5 02_01_0776 + 5779673-5779987 29 4.5 01_05_0562 - 23307526-23307875,23308149-23308452,23308543-23308647 29 4.5 05_04_0035 + 17378541-17381276 28 6.0 03_05_1125 + 30576951-30577010,30577163-30577285,30577393-305775... 28 6.0 03_02_0786 - 11169820-11170158,11170245-11170433,11171173-111714... 28 6.0 12_01_0286 - 2127622-2127897,2128611-2128997,2129195-2129550,212... 28 7.9 08_01_0080 + 566509-566746,566904-567151,567347-567532,567639-56... 28 7.9 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 28 7.9 06_02_0120 + 12055076-12055175,12055322-12055725 28 7.9 04_04_1577 + 34554819-34554995,34555672-34555754,34555906-345562... 28 7.9 03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223,863... 28 7.9 03_02_0402 - 8151448-8151669,8151916-8152417,8154537-8155105 28 7.9 02_05_0325 - 27951570-27952808 28 7.9 01_06_0182 - 27264990-27265049,27265531-27265648,27265733-272658... 28 7.9 01_03_0270 + 14445240-14445464,14445490-14445655,14446193-144463... 28 7.9 01_03_0145 - 13116302-13116958,13117365-13117430,13117786-131180... 28 7.9 >06_03_0138 + 17093196-17093325,17095704-17095804,17096224-17096292, 17096403-17097650,17097763-17097871,17099459-17099655, 17099732-17099842,17099927-17100079 Length = 705 Score = 36.7 bits (81), Expect = 0.017 Identities = 22/58 (37%), Positives = 29/58 (50%) Frame = +3 Query: 321 AQPLPGMQHGFQPGFQPGYQPGFAPGYPQPSGYPVPVMQQPGPQAPGGWMNMPQGLQQ 494 + P+P +G P Y PGF Y PSG+P +QQP P + +PQ LQQ Sbjct: 198 SSPMPSSANGAGLTMPPMYWPGF---YTPPSGFPH--LQQPPFLRPPHGLTIPQALQQ 250 >07_01_0479 + 3606663-3607448 Length = 261 Score = 36.3 bits (80), Expect = 0.023 Identities = 19/43 (44%), Positives = 20/43 (46%) Frame = +3 Query: 354 QPGFQPGYQPGFAPGYPQPSGYPVPVMQQPGPQAPGGWMNMPQ 482 +PG G PG PG P P P PGPQ PG N PQ Sbjct: 221 RPGMPGGPPPGMRPGMPPPPFRPGMPPPPPGPQQPG--QNPPQ 261 Score = 35.5 bits (78), Expect = 0.039 Identities = 21/46 (45%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +3 Query: 324 QPLPGMQHGFQPGFQPGY-QPGFAPGYPQPSGYPVPVMQQPGPQAP 458 Q PGM G PG +PG P F PG P P P QQPG P Sbjct: 219 QVRPGMPGGPPPGMRPGMPPPPFRPGMPPPP----PGPQQPGQNPP 260 >07_03_1067 + 23728642-23728690,23728832-23729010 Length = 75 Score = 35.9 bits (79), Expect = 0.030 Identities = 21/47 (44%), Positives = 23/47 (48%), Gaps = 4/47 (8%) Frame = +3 Query: 324 QPLPGMQHGFQPGFQP-GYQP--GFAP-GYPQPSGYPVPVMQQPGPQ 452 Q PG PG+ P GY P G+ P GYP GYP P Q P Q Sbjct: 16 QGYPGKDGYPPPGYPPAGYPPAQGYPPAGYPPQQGYPPPYAQPPPQQ 62 Score = 31.9 bits (69), Expect = 0.49 Identities = 21/48 (43%), Positives = 24/48 (50%), Gaps = 8/48 (16%) Frame = +3 Query: 348 GFQP-GFQP--GYQP-GFAP--GYPQPSGYPVPVMQQ--PGPQAPGGW 467 G+ P G+ P GY P G+ P GYP P P P QQ GP GW Sbjct: 28 GYPPAGYPPAQGYPPAGYPPQQGYPPPYAQPPPQQQQHSSGPSFMEGW 75 >03_01_0164 - 1326002-1326409,1326410-1326428,1326523-1326647, 1327482-1327530,1328834-1328855,1328969-1329071 Length = 241 Score = 35.9 bits (79), Expect = 0.030 Identities = 24/59 (40%), Positives = 25/59 (42%), Gaps = 5/59 (8%) Frame = +3 Query: 324 QPLPGMQHGFQPGFQP--GYQPGFAP--GYPQPSGYPVP-VMQQPGPQAPGGWMNMPQG 485 QP G +G P P GY P P GYPQ YP P PG P G PQG Sbjct: 179 QPAYGQPYGGYPPAPPAQGYPPAAYPPAGYPQGGAYPPPGSYPPPGSYPPQGSYPPPQG 237 >01_02_0007 + 10132380-10133201 Length = 273 Score = 34.7 bits (76), Expect = 0.069 Identities = 21/44 (47%), Positives = 23/44 (52%) Frame = +3 Query: 327 PLPGMQHGFQPGFQPGYQPGFAPGYPQPSGYPVPVMQQPGPQAP 458 PLPG Q QPG QP P P P P+ P+P QP P AP Sbjct: 98 PLPGPQPLPQPGPQPNPNPQPLP-QPNPNPQPLP---QPDPNAP 137 Score = 33.5 bits (73), Expect = 0.16 Identities = 22/44 (50%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +3 Query: 324 QPLPGMQHGFQPGFQPGYQPGFAPGYPQPSGYPVPVMQ-QPGPQ 452 QPLP Q QP PG QP PG PQP+ P P+ Q P PQ Sbjct: 85 QPLPQPQPQPQPLPLPGPQPLPQPG-PQPNPNPQPLPQPNPNPQ 127 >04_03_0742 + 19200045-19200053,19200158-19200437,19201331-19201545, 19201705-19201792,19202277-19202842 Length = 385 Score = 33.1 bits (72), Expect = 0.21 Identities = 14/45 (31%), Positives = 20/45 (44%), Gaps = 4/45 (8%) Frame = +3 Query: 333 PGMQHGFQPGFQPGYQPGFAPGYP----QPSGYPVPVMQQPGPQA 455 PG + + P + P Y P + P YP PS +P + P A Sbjct: 337 PGPGYAYPPPYPPSYPPPYQPSYPPYPSHPSHHPSQIFSDENPNA 381 >09_01_0165 - 2436769-2437442,2438159-2438224,2438318-2438415, 2439856-2440214 Length = 398 Score = 32.7 bits (71), Expect = 0.28 Identities = 21/53 (39%), Positives = 25/53 (47%), Gaps = 2/53 (3%) Frame = +3 Query: 333 PGMQHGFQPGFQPGYQPGFAPGYPQP--SGYPVPVMQQPGPQAPGGWMNMPQG 485 PG Q G PG+ G P + G P P +G PV PG Q GG + QG Sbjct: 326 PGYQGG-GPGYHGGNPPPYQAGNPPPYQAGNPVFAGGAPGYQGQGGNPSYQQG 377 Score = 29.1 bits (62), Expect = 3.4 Identities = 20/47 (42%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = +3 Query: 330 LPGMQHGFQPGFQPGYQPGFAPGYPQPSGYP--VPVMQQPGPQAPGG 464 +PG Q G PG+Q G Q P P PS Y P Q GP GG Sbjct: 293 VPGYQ-GRAPGYQGGNQEYRGPPPPPPSAYQGNNPGYQGGGPGYHGG 338 >09_04_0684 - 19442335-19442990,19443774-19443839,19443935-19444032, 19444787-19445157 Length = 396 Score = 31.9 bits (69), Expect = 0.49 Identities = 15/30 (50%), Positives = 17/30 (56%) Frame = +3 Query: 333 PGMQHGFQPGFQPGYQPGFAPGYPQPSGYP 422 PG Q G P +Q G PG+APGY G P Sbjct: 342 PGYQGGNPPPYQGG-NPGYAPGYHGQGGNP 370 >09_01_0079 - 1159963-1160211,1160303-1160509,1160631-1160801, 1161732-1161869,1162184-1162273,1162354-1162431, 1162510-1163166,1163245-1163363,1164305-1164584 Length = 662 Score = 31.9 bits (69), Expect = 0.49 Identities = 23/61 (37%), Positives = 28/61 (45%), Gaps = 4/61 (6%) Frame = +3 Query: 324 QPLPGM---QHGFQPGFQPGYQPGFAPGYPQPSGYPVPVMQQ-PGPQAPGGWMNMPQGLQ 491 QP P Q GF GFQ PG PG + +P++QQ PQ P G G+Q Sbjct: 445 QPPPAFINTQPGF--GFQQPLMPGMRPGAGPMPNFIMPMVQQGQQPQRPAGRRAGAGGMQ 502 Query: 492 Q 494 Q Sbjct: 503 Q 503 >08_01_0178 - 1509100-1511214 Length = 704 Score = 31.9 bits (69), Expect = 0.49 Identities = 16/49 (32%), Positives = 20/49 (40%) Frame = +2 Query: 245 VTPSSSKRLSWPTTHSYATPRPTSWGTTPSGHAAWVPARISTWLSTRIC 391 V P+ + R W S P+P TTP G P R+ W S C Sbjct: 41 VCPACNAR--WTNAPSNPPPQPAGGSTTPFGQTTGFPMRVRPWSSCDKC 87 >05_05_0173 + 22956927-22958615 Length = 562 Score = 31.9 bits (69), Expect = 0.49 Identities = 20/53 (37%), Positives = 26/53 (49%), Gaps = 2/53 (3%) Frame = +1 Query: 169 PTPYSPNFPASH-GYVPPPEGEKPNESYPIILKAAILA-HHPLLCHTPAYILG 321 P PY P+ P +H YVPPP P E+ P + HP L P+ +LG Sbjct: 83 PEPYDPSAPEAHPPYVPPP--VPPPEAIPELADDLEFGFSHPPLLLRPSELLG 133 >05_01_0142 - 940421-940701,941262-941574 Length = 197 Score = 31.9 bits (69), Expect = 0.49 Identities = 20/52 (38%), Positives = 23/52 (44%), Gaps = 3/52 (5%) Frame = +3 Query: 321 AQPLPGMQHGFQPGFQPGYQPGFAP--GYPQPSGYPVP-VMQQPGPQAPGGW 467 A P P + PG P + P GYPQP GYP P Q G P G+ Sbjct: 46 AYPPPPGAYPPPPGAYPPPPGAYPPQHGYPQPGGYPPPGGYPQHGGYPPAGY 97 Score = 28.7 bits (61), Expect = 4.5 Identities = 21/46 (45%), Positives = 24/46 (52%), Gaps = 5/46 (10%) Frame = +3 Query: 345 HGFQP--GFQP-GYQPGFAPG-YPQPSG-YPVPVMQQPGPQAPGGW 467 HG+ P G+ P GY P PG YP P G YP P P P PG + Sbjct: 27 HGYPPHQGYPPQGYPP--PPGAYPPPPGAYPPPPGAYPPP--PGAY 68 >03_06_0471 + 34169562-34169892,34170121-34170347 Length = 185 Score = 31.9 bits (69), Expect = 0.49 Identities = 16/42 (38%), Positives = 19/42 (45%) Frame = +3 Query: 360 GFQPGYQPGFAPGYPQPSGYPVPVMQQPGPQAPGGWMNMPQG 485 GF Y G+ YP GYP Q P PGG+ + P G Sbjct: 16 GFHGAYPSGYPGAYPLMQGYPNSPGQYP---TPGGYPSAPPG 54 Score = 31.9 bits (69), Expect = 0.49 Identities = 20/45 (44%), Positives = 23/45 (51%) Frame = +3 Query: 333 PGMQHGFQPGFQPGYQPGFAPGYPQPSGYPVPVMQQPGPQAPGGW 467 PG Q + P P Q G+ PG PSGYP QQPG P G+ Sbjct: 63 PGAQ--YPPSGYPPSQGGYPPGAYPPSGYP----QQPG-YPPAGY 100 Score = 28.3 bits (60), Expect = 6.0 Identities = 19/46 (41%), Positives = 21/46 (45%), Gaps = 6/46 (13%) Frame = +3 Query: 345 HGFQPGFQPGYQP---GF--APG-YPQPSGYPVPVMQQPGPQAPGG 464 HG P PG P G+ +PG YP P GYP PG P G Sbjct: 18 HGAYPSGYPGAYPLMQGYPNSPGQYPTPGGYP---SAPPGQYPPAG 60 >11_06_0610 - 25449085-25453284 Length = 1399 Score = 31.5 bits (68), Expect = 0.64 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +1 Query: 148 ELTMSHKPTPYSPNFPASHGYVPPPEGEKPNE 243 E + +++ P +P+ P SHG PPPE E P E Sbjct: 440 EKSPAYEEPPAAPSTPTSHGP-PPPEEESPEE 470 Score = 28.3 bits (60), Expect = 6.0 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = +1 Query: 169 PTPYSPNFPASHGYVPPPEGEKP 237 PT YSP PA+ PPPEG+ P Sbjct: 536 PTEYSP--PATPESSPPPEGKSP 556 >02_02_0119 + 6978697-6979045,6979519-6979581,6979757-6979866, 6979969-6980154,6980266-6980361,6980493-6980564, 6980798-6980909,6982448-6982534,6982680-6983872 Length = 755 Score = 31.1 bits (67), Expect = 0.85 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +3 Query: 345 HGFQPGFQPGYQPGFAPGYPQPSGYPVPVMQQPGPQAPGG 464 HG P QPGY GY QP YP Q PQ P G Sbjct: 394 HGGAPMQQPGY------GYMQPGAYPGAPPQYGAPQQPYG 427 Score = 27.9 bits (59), Expect = 7.9 Identities = 20/51 (39%), Positives = 22/51 (43%), Gaps = 4/51 (7%) Frame = +3 Query: 327 PLPGMQHGFQPGFQPGYQPGFAPGYPQPSGYP---VPVMQQPGP-QAPGGW 467 P P +G QP Q GY G PQ P P Q P P APGG+ Sbjct: 610 PPPQTGYGTQPQPQGGYSQGSYGAPPQGQKAPPNTSPYGQAPPPGSAPGGY 660 >04_04_0435 - 25170348-25170593,25170989-25171189,25171580-25171756, 25172284-25172418,25173131-25173262,25173292-25173369, 25173452-25174108,25174210-25174328,25175897-25176173 Length = 673 Score = 30.7 bits (66), Expect = 1.1 Identities = 19/39 (48%), Positives = 20/39 (51%) Frame = +3 Query: 342 QHGFQPGFQPGYQPGFAPGYPQPSGYPVPVMQQPGPQAP 458 Q GF GFQ PG PG Y VPV+QQ G Q P Sbjct: 466 QPGF--GFQQQLVPGMRPGGAHMPNYFVPVVQQ-GQQGP 501 >04_01_0453 + 5869627-5870232,5870383-5870897,5870964-5871600 Length = 585 Score = 30.7 bits (66), Expect = 1.1 Identities = 22/55 (40%), Positives = 25/55 (45%), Gaps = 5/55 (9%) Frame = +3 Query: 336 GMQHGFQPGFQPGYQPGFAP-GYPQPSGYPVPVMQQPGPQ----APGGWMNMPQG 485 G GF PGF G Q G AP G + G P +PGP+ GGW N G Sbjct: 19 GFARGFHPGFVVGNQHGGAPGGRGRGRGRGRPT-GRPGPRHEFSHAGGWNNFGGG 72 >12_02_1174 - 26696869-26698191 Length = 440 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/45 (33%), Positives = 17/45 (37%) Frame = +3 Query: 324 QPLPGMQHGFQPGFQPGYQPGFAPGYPQPSGYPVPVMQQPGPQAP 458 QP P +Q P P P P QP P P + P P P Sbjct: 180 QPPPSLQPPSPPPPPPTRPPSVKPPVVQPKPQPPPTLPPPSPPPP 224 >07_03_1160 - 24430240-24431268 Length = 342 Score = 30.3 bits (65), Expect = 1.5 Identities = 17/45 (37%), Positives = 22/45 (48%) Frame = +3 Query: 324 QPLPGMQHGFQPGFQPGYQPGFAPGYPQPSGYPVPVMQQPGPQAP 458 QP PG+ P P +P P P+P G P+P + QP P P Sbjct: 67 QPTPGVPPLPNPDVPPMNKPDVPP-MPKPDGPPIPPV-QPCPDQP 109 >02_05_0970 - 33179180-33179210,33179297-33179441,33180307-33180362, 33180650-33180691,33180814-33180866,33181059-33181490, 33181630-33181707,33181785-33181870,33183588-33183689, 33183754-33183960,33184976-33185336,33185463-33185626, 33185709-33185817,33186468-33186485 Length = 627 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 369 PGYQPGFAPGYPQPSGYPVPVMQQPGPQAPGGWM--NMPQGLQQLP 500 P F+ SG P +QQPG PG + N+P G+ Q+P Sbjct: 54 PNMPGSFSQRNAAMSGLPSSGVQQPGGSMPGRFASNNLPVGMSQIP 99 >02_05_0700 + 31018480-31019832 Length = 450 Score = 30.3 bits (65), Expect = 1.5 Identities = 22/52 (42%), Positives = 25/52 (48%), Gaps = 6/52 (11%) Frame = +3 Query: 324 QPLPGMQHGFQPGFQPGYQ-PGFA-PGYP----QPSGYPVPVMQQPGPQAPG 461 QPLPG QP PG PG + PG P +P G P+P PG PG Sbjct: 54 QPLPGQSLPGQP--LPGQPLPGQSLPGQPLVGEKPPGQPLPGQPLPGQSLPG 103 >08_02_1403 + 26811020-26811146,26813351-26813609,26814932-26814983 Length = 145 Score = 29.9 bits (64), Expect = 2.0 Identities = 12/26 (46%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Frame = +1 Query: 178 YSPN-FPASHGYVPPPEGEKPNESYP 252 Y P +P+SHG PPP+G P P Sbjct: 60 YPPQGYPSSHGVYPPPQGPYPPPHQP 85 >08_02_0163 + 13470178-13470335,13470635-13470656,13470885-13471055, 13471157-13471363,13471458-13471700 Length = 266 Score = 29.9 bits (64), Expect = 2.0 Identities = 20/58 (34%), Positives = 26/58 (44%), Gaps = 1/58 (1%) Frame = +3 Query: 324 QPLPGMQHGFQPGFQPGYQPGFAPGYPQPSGYPVPVMQQ-PGPQAPGGWMNMPQGLQQ 494 QP+PG GFQ PG P + +P++QQ PQ P G G+QQ Sbjct: 58 QPMPGF------GFQQHLIPGMRPSVGPIPNFVMPMVQQGQQPQRPAGRRAGTGGIQQ 109 >04_03_0711 + 18945012-18945692,18945790-18946845,18946863-18947066 Length = 646 Score = 29.9 bits (64), Expect = 2.0 Identities = 21/64 (32%), Positives = 25/64 (39%), Gaps = 2/64 (3%) Frame = +3 Query: 324 QPLPGMQHGFQ--PGFQPGYQPGFAPGYPQPSGYPVPVMQQPGPQAPGGWMNMPQGLQQL 497 QP+P +G P P Y P P Y S YP QP P P + Q L Sbjct: 510 QPVPAPVYGTSGAPNAPPMYPP---PPYGYASYYPSVTPVQPPPPPPPAGADPSQSLANA 566 Query: 498 PSRL 509 P +L Sbjct: 567 PGQL 570 >01_07_0188 - 41866689-41866763,41866889-41867155,41867277-41867722, 41867945-41868033,41868279-41868368,41868661-41868739, 41868979-41869042,41869597-41869684,41869776-41869836, 41869906-41869969,41870134-41870188,41870275-41870346, 41870469-41870551,41870629-41870724,41871279-41871383, 41872159-41872227,41872470-41872561,41872667-41872886 Length = 704 Score = 29.5 bits (63), Expect = 2.6 Identities = 28/65 (43%), Positives = 28/65 (43%), Gaps = 11/65 (16%) Frame = +3 Query: 321 AQPLPGMQHGFQ----PGFQPGYQPGFAPGYPQPS------GYPVPVMQQPGPQAP-GGW 467 A PL G HG Q PG PG QP PG P PS MQQ PQ P Sbjct: 488 AMPLDGSDHGEQRPSIPGLPPG-QPPLPPG-PHPSLLAGGQQQQYQQMQQQHPQFPRPPP 545 Query: 468 MNMPQ 482 NMPQ Sbjct: 546 PNMPQ 550 >01_06_1805 - 39999987-40000169,40000648-40000974,40001724-40002017, 40002112-40002231,40002714-40002776,40003150-40003310, 40003864-40004035 Length = 439 Score = 29.5 bits (63), Expect = 2.6 Identities = 17/39 (43%), Positives = 21/39 (53%) Frame = +3 Query: 399 YPQPSGYPVPVMQQPGPQAPGGWMNMPQGLQQLPSRLEY 515 +P+ S P P Q P AP M +PQGL Q+PS Y Sbjct: 234 FPRGSFIPSPRWQNPSNYAP---MIVPQGLVQVPSWNSY 269 >12_02_0046 + 12830974-12832386 Length = 470 Score = 29.1 bits (62), Expect = 3.4 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +1 Query: 172 TPYSPNFPASHGYVPPPEGEKPNESYPI 255 TP SP+ P + PPP + P +SY I Sbjct: 342 TPPSPHAPRHDPFEPPPSPDPPIQSYAI 369 >09_04_0506 - 18188785-18190599 Length = 604 Score = 29.1 bits (62), Expect = 3.4 Identities = 20/48 (41%), Positives = 22/48 (45%), Gaps = 2/48 (4%) Frame = +3 Query: 360 GF-QPGYQPGFAPGYPQPSGYPVPVMQQPGP-QAPGGWMNMPQGLQQL 497 GF Q + P P PQ P P+ QQP P QAP Q QQL Sbjct: 43 GFLQSSHPPPQPPPPPQQQQQPPPISQQPPPLQAPPPPPQQQQQQQQL 90 >09_04_0424 + 17444261-17444665,17445974-17446367,17447367-17447425, 17447507-17447637,17447737-17447833,17447936-17448100 Length = 416 Score = 29.1 bits (62), Expect = 3.4 Identities = 18/41 (43%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Frame = +3 Query: 351 FQPGFQPGYQPGFAPGYPQPSGYPVPV---MQQPGPQAPGG 464 F P F P + G P PQP P PV M P P A GG Sbjct: 63 FAPHFVPFHAVG-PPPPPQPRAAPPPVAVAMGSPAPHAQGG 102 >07_03_1546 + 27602598-27602917,27602995-27603052,27603130-27603252, 27603896-27603992,27604095-27604131,27604244-27604349, 27604547-27604604,27604705-27604802,27604911-27605030, 27605622-27605667,27606336-27606522,27606747-27607263, 27607361-27607453,27608101-27608286,27608364-27608574, 27609263-27609387,27609518-27609664,27610114-27610236, 27610445-27610799,27611076-27611305,27611785-27611877 Length = 1109 Score = 29.1 bits (62), Expect = 3.4 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 6/41 (14%) Frame = +3 Query: 351 FQPGFQPGY--QPGFAPGYP----QPSGYPVPVMQQPGPQA 455 F P PG+ +PG +P P Q G P PV+ P P A Sbjct: 951 FMPSNNPGFVQRPGLSPVQPSSPTQAQGQPQPVVAPPAPPA 991 >07_03_1315 - 25722757-25722876,25722972-25723328,25723924-25724500, 25724577-25725265,25725487-25725822,25726190-25726527, 25726619-25726746,25726906-25727030,25727547-25727589, 25727714-25727802,25728396-25728511,25729157-25729276, 25729752-25729794 Length = 1026 Score = 29.1 bits (62), Expect = 3.4 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +1 Query: 265 AAILAHHPLLCHTPAYILGHNPF 333 A +LAH L C+TP ++ G PF Sbjct: 476 AEVLAHGSLRCYTPVHLSGRVPF 498 >01_01_0907 + 7128397-7128497,7129944-7130022,7130470-7130568, 7130654-7130767,7130960-7131102,7131716-7131797, 7132425-7132510,7132879-7133112,7134684-7135162, 7135309-7136027 Length = 711 Score = 29.1 bits (62), Expect = 3.4 Identities = 27/93 (29%), Positives = 35/93 (37%), Gaps = 1/93 (1%) Frame = +3 Query: 357 PGFQPGYQ-PGFAPGYPQPSGYPVPVMQQPGPQAPGGWMNMPQGLQQLPSRLEYLSMIDQ 533 P PG Q PG P P P PV + QP + MPQ P +Y + Sbjct: 575 PHSMPGMQFPGMQPS-PMPGAQPVMMYAQPMMMPGMQFAAMPQPRMYGPQMSQY-----R 628 Query: 534 LIMHQKVELLEAFVGFETNNKYTVMXSVGQKVY 632 L+ Q + G T Y M + QK+Y Sbjct: 629 LVQQQAAQYYSNSQGRPT--YYAGMNDLSQKMY 659 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 28.7 bits (61), Expect = 4.5 Identities = 17/46 (36%), Positives = 19/46 (41%) Frame = +3 Query: 324 QPLPGMQHGFQPGFQPGYQPGFAPGYPQPSGYPVPVMQQPGPQAPG 461 QP P +G P QP Y P P G P P + P P PG Sbjct: 21 QPPPMNPYGPPPPQQPAYGH-----MPPPQGAPPPFLAPPPPPPPG 61 >05_01_0492 - 4102379-4103494,4104105-4104383,4105395-4105724 Length = 574 Score = 28.7 bits (61), Expect = 4.5 Identities = 12/38 (31%), Positives = 16/38 (42%) Frame = +1 Query: 124 IYEKGYETELTMSHKPTPYSPNFPASHGYVPPPEGEKP 237 ++++ E P Y PN YVPPP G P Sbjct: 381 VHQQPEEVAAPYGPPPQSYPPNVRLPSPYVPPPSGPAP 418 Score = 28.3 bits (60), Expect = 6.0 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +3 Query: 348 GFQPGFQPGYQPGFAPGYPQPSGY 419 G P + GY+P G+P+P GY Sbjct: 438 GPPPSYNTGYKPQGGGGFPEPYGY 461 >04_03_0689 + 18746735-18748296,18748401-18748485 Length = 548 Score = 28.7 bits (61), Expect = 4.5 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = +3 Query: 396 GYPQPSGYPVPVMQQPGPQAPGGWMNMPQGLQQLPS 503 G P P+ P P + P PQ GG P G + PS Sbjct: 5 GNPNPNSTPTPQPRPPQPQQQGGSPATPLGHLRPPS 40 >02_01_0776 + 5779673-5779987 Length = 104 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/39 (33%), Positives = 18/39 (46%) Frame = -1 Query: 552 LSDALSVGQSWKGIPTSRAVAEGLAAYSSNHLELVDLVV 436 L+D G+ W P SR + HL+L+ LVV Sbjct: 33 LADGNGAGRGWLPCPDSRGGTSAVVGGGQRHLDLMGLVV 71 >01_05_0562 - 23307526-23307875,23308149-23308452,23308543-23308647 Length = 252 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +3 Query: 351 FQPGFQPGYQPGFAPGYPQPSGYPVPVMQQPGPQ 452 F G +PG +P P P+P P P +PGP+ Sbjct: 153 FHHGPKPGPKPKPKPSPPKPKPGPKPKPPKPGPK 186 >05_04_0035 + 17378541-17381276 Length = 911 Score = 28.3 bits (60), Expect = 6.0 Identities = 12/29 (41%), Positives = 18/29 (62%), Gaps = 3/29 (10%) Frame = +3 Query: 378 QPGFAPGYPQPSGYPVPVMQQP---GPQA 455 QPG+ +P +G+ P +QQP GPQ+ Sbjct: 746 QPGYGTSHPWHTGFNAPQVQQPSYGGPQS 774 >03_05_1125 + 30576951-30577010,30577163-30577285,30577393-30577552, 30577635-30577702,30577928-30578473,30578725-30579312, 30579392-30579604,30580227-30580388 Length = 639 Score = 28.3 bits (60), Expect = 6.0 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = +3 Query: 375 YQPGFAPGYPQPSGYPVPVMQQPGPQAPGGWMNMPQGLQQLPS 503 Y G+AP P PSG PVP + G P Q P+ Sbjct: 145 YGYGYAPYGPYPSGSPVPTVGHDGQSYGAQHYQYPGQYYQQPA 187 >03_02_0786 - 11169820-11170158,11170245-11170433,11171173-11171469, 11171568-11171630,11171884-11171997,11173011-11173091, 11173176-11173307,11174265-11174363,11174453-11174530, 11174641-11174901 Length = 550 Score = 28.3 bits (60), Expect = 6.0 Identities = 18/45 (40%), Positives = 20/45 (44%) Frame = +3 Query: 354 QPGFQPGYQPGFAPGYPQPSGYPVPVMQQPGPQAPGGWMNMPQGL 488 +PGF P P P P PVPVM G P W +PQ L Sbjct: 23 RPGFPVAPPPPMGPPPPPPMP-PVPVMYLRGVPPPPPW--LPQHL 64 >12_01_0286 - 2127622-2127897,2128611-2128997,2129195-2129550, 2129923-2130046,2130128-2130196,2131190-2131238, 2132222-2132336,2132854-2132903,2133000-2133137, 2134182-2134228 Length = 536 Score = 27.9 bits (59), Expect = 7.9 Identities = 14/48 (29%), Positives = 19/48 (39%) Frame = +3 Query: 390 APGYPQPSGYPVPVMQQPGPQAPGGWMNMPQGLQQLPSRLEYLSMIDQ 533 A +PQ +GY Q G W G QQ+P +Y+ Q Sbjct: 310 AQAWPQTNGYDAIQAQMVAAGYQGEWSGYQYGEQQMPYPEQYMQQSTQ 357 >08_01_0080 + 566509-566746,566904-567151,567347-567532,567639-567734, 567836-567907,567990-568106,570531-571676 Length = 700 Score = 27.9 bits (59), Expect = 7.9 Identities = 19/59 (32%), Positives = 22/59 (37%), Gaps = 2/59 (3%) Frame = +3 Query: 324 QPLPGMQHGFQPGFQPGYQPGFAPGYPQPSGYPV--PVMQQPGPQAPGGWMNMPQGLQQ 494 QP G Q G+ P P +P PG P G P Q P P + G P Q Sbjct: 477 QPPAGPQQGYPPQQDPYARPYGGPGQWAPRGAPAGDGTYQAPPPTSYGPPSQQPPAYGQ 535 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 27.9 bits (59), Expect = 7.9 Identities = 17/53 (32%), Positives = 19/53 (35%) Frame = +3 Query: 357 PGFQPGYQPGFAPGYPQPSGYPVPVMQQPGPQAPGGWMNMPQGLQQLPSRLEY 515 P P P P P P P P+ QP P P + P L P EY Sbjct: 1177 PSLPPPPPPPPLPSGPPPQPAPPPLPIQPPPIPPPPVPSSPSSLGYQPPAPEY 1229 >06_02_0120 + 12055076-12055175,12055322-12055725 Length = 167 Score = 27.9 bits (59), Expect = 7.9 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 4/32 (12%) Frame = +3 Query: 336 GMQHG---FQPGFQPGY-QPGFAPGYPQPSGY 419 G +HG QP + GY QPG+ GY QP GY Sbjct: 58 GYEHGGGYSQPRYGGGYGQPGYGGGYGQP-GY 88 Score = 27.9 bits (59), Expect = 7.9 Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 5/32 (15%) Frame = +3 Query: 321 AQPLPGMQHGFQPGF-----QPGYQPGFAPGY 401 +QP G +G QPG+ QPGY G+ PGY Sbjct: 66 SQPRYGGGYG-QPGYGGGYGQPGYGSGYGPGY 96 >04_04_1577 + 34554819-34554995,34555672-34555754,34555906-34556229, 34556347-34556602,34556951-34557031,34557106-34557213, 34557300-34557329,34557475-34557612,34557737-34557774, 34557858-34557957,34558194-34558268 Length = 469 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -1 Query: 552 LSDALSVGQSWKGIPTSRAVAEGLAAYSS 466 L DAL G +W+G P + + A LA+ +S Sbjct: 14 LRDALLRGSAWRGAPAANSAAARLASTAS 42 >03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223, 8631332-8631397,8631891-8631967,8632659-8633070 Length = 351 Score = 27.9 bits (59), Expect = 7.9 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = +3 Query: 357 PGFQPGYQPGFAPGYPQPSGYPVPVMQQPGPQAPGGWMNMPQGLQQLP 500 PG P G P P P P P Q P P P M MP + P Sbjct: 254 PGTLPNGSGG--PPRPPPPQVPPPPPQAPPPPPPNAPMGMPPRIPPPP 299 >03_02_0402 - 8151448-8151669,8151916-8152417,8154537-8155105 Length = 430 Score = 27.9 bits (59), Expect = 7.9 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 363 FQPGYQPGFAPGYPQPSGYPVPVMQQPGPQAP 458 F P P PG+P SG P P QP P Sbjct: 113 FPPSAHPQHYPGWPGVSGRPHPCGLQPAMPTP 144 >02_05_0325 - 27951570-27952808 Length = 412 Score = 27.9 bits (59), Expect = 7.9 Identities = 14/48 (29%), Positives = 24/48 (50%) Frame = +2 Query: 224 KEKSQMKVTPSSSKRLSWPTTHSYATPRPTSWGTTPSGHAAWVPARIS 367 KE+ + + + + + T + A P PTS ++P+ HAA A S Sbjct: 11 KEEEDEEQDEAGRREIPFMTATAEAAPAPTSSSSSPAHHAASASASAS 58 >01_06_0182 - 27264990-27265049,27265531-27265648,27265733-27265811, 27266816-27267116 Length = 185 Score = 27.9 bits (59), Expect = 7.9 Identities = 17/56 (30%), Positives = 24/56 (42%) Frame = +3 Query: 357 PGFQPGYQPGFAPGYPQPSGYPVPVMQQPGPQAPGGWMNMPQGLQQLPSRLEYLSM 524 P PG P A G+PQP+ P + P P P + P Q P+ Y ++ Sbjct: 40 PSSAPGEVPQPAVGFPQPAP-PPGLRHYPQPPPPSYAVYPPLPPQTYPAAAPYYAL 94 >01_03_0270 + 14445240-14445464,14445490-14445655,14446193-14446341, 14446634-14446674,14447683-14447755 Length = 217 Score = 27.9 bits (59), Expect = 7.9 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +1 Query: 184 PNFPASHGYVPPPEGEKPNESYPII 258 P+ P S G +PPP +P +P++ Sbjct: 13 PSPPPSCGGIPPPPSRRPRPPHPVV 37 >01_03_0145 - 13116302-13116958,13117365-13117430,13117786-13118065, 13118283-13119028 Length = 582 Score = 27.9 bits (59), Expect = 7.9 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +1 Query: 115 RQLIYEKGYETELTMSHKPTPYSPNFPASHGYVPP 219 R+LI ++ + S +PYSPNFP+S + P Sbjct: 280 RELIIFGNNQSPSSSSPALSPYSPNFPSSPNPISP 314 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,874,303 Number of Sequences: 37544 Number of extensions: 405319 Number of successful extensions: 2009 Number of sequences better than 10.0: 51 Number of HSP's better than 10.0 without gapping: 1680 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1971 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1726796312 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -