BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060822.seq (695 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q7YU13 Cluster: LD26355p; n=3; Diptera|Rep: LD26355p - ... 36 1.3 UniRef50_Q6F794 Cluster: Putative uncharacterized protein; n=1; ... 34 3.8 UniRef50_Q6A022 Cluster: MKIAA0668 protein; n=4; Theria|Rep: MKI... 33 8.8 >UniRef50_Q7YU13 Cluster: LD26355p; n=3; Diptera|Rep: LD26355p - Drosophila melanogaster (Fruit fly) Length = 1654 Score = 35.5 bits (78), Expect = 1.3 Identities = 18/39 (46%), Positives = 23/39 (58%) Frame = +3 Query: 132 LPAEQSGAQLGTTVPVPHDIPQAPGKPEENATAVQPTKQ 248 +P Q AQL TTVP+P + Q+P P N AVQ +Q Sbjct: 1497 VPRRQKHAQLATTVPIPPSLAQSPRAP-SNLEAVQLQQQ 1534 >UniRef50_Q6F794 Cluster: Putative uncharacterized protein; n=1; Acinetobacter sp. ADP1|Rep: Putative uncharacterized protein - Acinetobacter sp. (strain ADP1) Length = 131 Score = 33.9 bits (74), Expect = 3.8 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = +3 Query: 135 PAEQSGAQLGTTVPVPHDIPQAPGKPEENATAVQPTKQN 251 P + A L P HD PQ P P + A QP QN Sbjct: 77 PMAPADAPLAPPAPAAHDAPQPPHDPVQQAAPAQPQDQN 115 >UniRef50_Q6A022 Cluster: MKIAA0668 protein; n=4; Theria|Rep: MKIAA0668 protein - Mus musculus (Mouse) Length = 694 Score = 32.7 bits (71), Expect = 8.8 Identities = 22/65 (33%), Positives = 31/65 (47%) Frame = -3 Query: 285 LSSVLVSTAEVCFVS*AELLLRFLQVYLELEGYHEERVL*FPVGLQTVQPAMLCTWQISV 106 L V V T F + L FL + L L G +P+GLQT+QPA++ W Sbjct: 227 LLDVFVLTRSRHFSLNLKSFLWFLLLLLLLTGLTYGAWHFYPLGLQTLQPAVVSWWAAKE 286 Query: 105 NRRTP 91 +R+ P Sbjct: 287 SRKQP 291 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 581,924,596 Number of Sequences: 1657284 Number of extensions: 9612656 Number of successful extensions: 27848 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 26614 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27831 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 54958682807 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -