BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060822.seq (695 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_0103 - 13425411-13425713,13425874-13425974,13426410-134264... 29 2.7 03_02_0770 + 11038971-11039392,11040071-11040353,11040697-11040798 28 6.2 01_06_0646 - 30832201-30832838,30833643-30833838,30833975-308341... 28 8.1 >07_03_0103 - 13425411-13425713,13425874-13425974,13426410-13426471, 13426951-13427123 Length = 212 Score = 29.5 bits (63), Expect = 2.7 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = +1 Query: 514 STEAKKEDATTPKSELAKSTEAPTHMEPTVQGKSI 618 ST A++ A +P+SE ++ A TH +P +G +I Sbjct: 108 STRAEESLALSPRSETVLNSSATTHTDPYSEGLAI 142 >03_02_0770 + 11038971-11039392,11040071-11040353,11040697-11040798 Length = 268 Score = 28.3 bits (60), Expect = 6.2 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = -3 Query: 339 DADTGVASVTFSASGFTFLSSVLVSTAEVCF 247 DAD GVA+V + G F S V ++ AE F Sbjct: 53 DADDGVAAVVLAGRGRAFCSGVDLTAAEEVF 83 >01_06_0646 - 30832201-30832838,30833643-30833838,30833975-30834126, 30834258-30834303,30834992-30835216,30835374-30835414, 30835705-30835834,30835951-30836019,30836254-30836307, 30836389-30836547,30836854-30836991,30837079-30837141, 30837225-30837264,30837369-30837415,30838062-30838373 Length = 769 Score = 27.9 bits (59), Expect = 8.1 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = +3 Query: 126 IALPAEQSGAQLGTTVPVPHDIPQAPGKPEENATAV 233 I LP E+ A LG V HD P APG + V Sbjct: 5 IILPKEEEAA-LGVAVEEDHDSPAAPGYQHQQGPPV 39 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,671,102 Number of Sequences: 37544 Number of extensions: 265474 Number of successful extensions: 740 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 725 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 740 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1780264028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -