BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060822.seq (695 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g02490.1 68415.m00188 hydroxyproline-rich glycoprotein family... 28 5.1 At1g21790.1 68414.m02727 expressed protein 28 5.1 At3g15970.1 68416.m02019 Ran-binding protein 1 domain-containing... 27 9.0 >At2g02490.1 68415.m00188 hydroxyproline-rich glycoprotein family protein related to LENOD2 [Lupinus luteus] gi|296830|emb|CAA39050; and genefinder Length = 302 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +3 Query: 138 AEQSGAQLGTTVPVPHDIPQAPGKPEENATAV 233 A+ S Q + P+PH +P +PG P T + Sbjct: 66 AKISVNQYPSVFPIPHPVPPSPGHPPHQNTKI 97 >At1g21790.1 68414.m02727 expressed protein Length = 288 Score = 28.3 bits (60), Expect = 5.1 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +2 Query: 38 YLTVYSC*KLALFQNEDLGVRLFTEICHVHSI 133 +L + C LAL++N + + T IC +HSI Sbjct: 152 HLVLLVCFTLALYRNVTINYLILTLICEMHSI 183 >At3g15970.1 68416.m02019 Ran-binding protein 1 domain-containing protein / RanBP1 domain-containing protein similar to Ran binding protein [Homo sapiens] GI:624232; contains Pfam profile PF00638: RanBP1 domain Length = 465 Score = 27.5 bits (58), Expect = 9.0 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = -3 Query: 375 ACSSGFTEAGTDDADTGVASVTFSASGFTF 286 A SS + + +A TG+AS FSAS F+F Sbjct: 237 ALSSFHQHSSSKNAFTGLASTGFSASSFSF 266 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,740,620 Number of Sequences: 28952 Number of extensions: 218587 Number of successful extensions: 601 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 583 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 601 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1487069504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -