BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060821.seq (630 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 26 0.35 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 26 0.35 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 24 1.4 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 23 2.4 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 23 2.4 S76958-1|AAB33933.1| 90|Apis mellifera olfactory receptor prot... 22 4.3 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 25.8 bits (54), Expect = 0.35 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = +2 Query: 209 AQNTCTLTRNQTEPTGALVAHNQVASIHFTNPLLVEQDVTTPSFP 343 A+ T R T+ T + A+NQV S + PLL + PS P Sbjct: 1070 AELRLTGLRPYTKYTLVVQAYNQVGSGPLSEPLLTQTMEDVPSIP 1114 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 25.8 bits (54), Expect = 0.35 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = +2 Query: 209 AQNTCTLTRNQTEPTGALVAHNQVASIHFTNPLLVEQDVTTPSFP 343 A+ T R T+ T + A+NQV S + PLL + PS P Sbjct: 1066 AELRLTGLRPYTKYTLVVQAYNQVGSGPLSEPLLTQTMEDVPSIP 1110 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 23.8 bits (49), Expect = 1.4 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 Query: 422 SRRTKPPFRSWRP 460 SRRT PP W+P Sbjct: 411 SRRTSPPPEDWKP 423 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 23.0 bits (47), Expect = 2.4 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +1 Query: 40 NVDFLGRKINNYHKKAASK 96 ++D L RKI Y+ +AASK Sbjct: 380 SIDTLARKILGYNLEAASK 398 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 23.0 bits (47), Expect = 2.4 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +1 Query: 40 NVDFLGRKINNYHKKAASK 96 ++D L RKI Y+ +AASK Sbjct: 380 SIDTLARKILGYNLEAASK 398 >S76958-1|AAB33933.1| 90|Apis mellifera olfactory receptor protein. Length = 90 Score = 22.2 bits (45), Expect = 4.3 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -3 Query: 106 LPFILTLPFCG 74 +P I+ LPFCG Sbjct: 20 IPVIIQLPFCG 30 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,011 Number of Sequences: 438 Number of extensions: 3717 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18826962 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -