BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060818.seq (663 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0665 - 18506221-18506271,18506331-18506401,18507097-185071... 31 0.62 06_03_1084 + 27483276-27483492,27483991-27484121,27484685-274847... 29 2.5 03_06_0034 + 31197846-31198417,31198562-31198987,31199074-311993... 29 3.3 12_02_1275 - 27482784-27483272 28 5.8 04_04_1696 + 35448667-35449641,35449726-35450562,35450667-354510... 28 5.8 02_05_1044 + 33728623-33728768,33728814-33728993,33729446-337295... 28 5.8 >04_03_0665 - 18506221-18506271,18506331-18506401,18507097-18507169, 18507476-18507805 Length = 174 Score = 31.5 bits (68), Expect = 0.62 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +3 Query: 153 WKWCGLRRDQTGREG 197 W WCGLRR + GR G Sbjct: 65 WMWCGLRRSKAGRRG 79 >06_03_1084 + 27483276-27483492,27483991-27484121,27484685-27484740, 27484834-27484891,27484970-27485113,27485270-27485353, 27485434-27485514,27485776-27485889,27486196-27486281, 27486376-27486436,27487343-27487525,27487987-27488038, 27488080-27488135,27488197-27488258,27488498-27488581, 27488899-27489030,27490220-27490316 Length = 565 Score = 29.5 bits (63), Expect = 2.5 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +1 Query: 424 CYGQAPALWPAAPRVSMMAKRLRNSYNYTTSCEQDLG 534 C PA PA+P V++ ++ + ++ NY CEQ LG Sbjct: 53 CVRTEPAPRPASP-VAVRSRSVHSTENYKKGCEQRLG 88 >03_06_0034 + 31197846-31198417,31198562-31198987,31199074-31199386, 31199510-31199560 Length = 453 Score = 29.1 bits (62), Expect = 3.3 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -2 Query: 248 AERLLPGALRDAPSPE*TFSTCLVSTESTPF 156 ++RL+ ALR PSP F++ L +TPF Sbjct: 39 SQRLVYAALRSLPSPRALFASLLSQLSATPF 69 >12_02_1275 - 27482784-27483272 Length = 162 Score = 28.3 bits (60), Expect = 5.8 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +3 Query: 150 QWKWCGLRRDQTGREG 197 +W W GLRR +TGR G Sbjct: 144 RWVWRGLRRTKTGRRG 159 >04_04_1696 + 35448667-35449641,35449726-35450562,35450667-35451001, 35451371-35451497,35451594-35451752,35451872-35453053, 35453164-35453424,35453513-35453761 Length = 1374 Score = 28.3 bits (60), Expect = 5.8 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -3 Query: 586 LGEINLELNFNGVLVLALQDLVHNLLCSCSCCGD 485 L IN NF+ L LQD++ N SCS CG+ Sbjct: 580 LYRINYYGNFDVSLGRYLQDILQNQNLSCSSCGE 613 >02_05_1044 + 33728623-33728768,33728814-33728993,33729446-33729523, 33729834-33729930,33730206-33730339,33730944-33731025, 33731631-33731717,33731875-33731981,33732674-33732845, 33733018-33733259,33733482-33733563,33733954-33734019, 33734040-33734159,33734935-33735012,33735083-33735178, 33735791-33735897,33736031-33736199,33736402-33736452, 33736567-33736650,33736946-33737040,33737175-33737265, 33737342-33737488,33737614-33737676 Length = 857 Score = 28.3 bits (60), Expect = 5.8 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = -1 Query: 483 LGHHGDSRRCWPKSWSLTIAGHLASRD 403 L D + WP W ++ AGH+++ D Sbjct: 76 LQRRADCKDTWPGQWDISSAGHISAGD 102 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,745,546 Number of Sequences: 37544 Number of extensions: 336504 Number of successful extensions: 1175 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1128 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1174 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1667659452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -