BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060816.seq (599 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0340 - 16934317-16934478,16934569-16934745,16934842-169349... 29 2.2 12_02_0776 - 23064167-23064239,23065214-23065518,23065614-230657... 28 5.0 11_06_0272 + 21806681-21806908,21806991-21807233,21807318-218074... 28 5.0 11_01_0709 - 5821246-5821449,5821517-5821634,5821720-5821812,582... 27 8.7 03_06_0642 + 35239658-35240083,35240167-35240238,35240305-352409... 27 8.7 >10_08_0340 - 16934317-16934478,16934569-16934745,16934842-16934940, 16935025-16935225,16935389-16935409,16935554-16935661, 16935749-16936130,16936693-16936912,16938673-16938827, 16938960-16939183,16939648-16939707 Length = 602 Score = 29.5 bits (63), Expect = 2.2 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +2 Query: 44 SXXYVTRKYCNKMWKLTVLGVFLTVTYVYSHT 139 S YV+R Y MW L+ L + LT TY S T Sbjct: 294 SRPYVSRWYMRMMWPLSWLSMVLTWTYGSSFT 325 >12_02_0776 - 23064167-23064239,23065214-23065518,23065614-23065727, 23065812-23065918,23065997-23066143,23066227-23066326, 23066421-23066522,23066702-23066776,23066973-23067152, 23067266-23067355,23067435-23067559,23067847-23067910, 23067993-23068197,23068818-23068966 Length = 611 Score = 28.3 bits (60), Expect = 5.0 Identities = 11/41 (26%), Positives = 22/41 (53%) Frame = -3 Query: 267 PAKVDVMQWDAVEVFCITYHTPSNLFISNPLIGSTMGHDPK 145 PA + ++ + V + + T ++FI P++G M H P+ Sbjct: 160 PAALAILHPSLLPVAIVGFFTKLSVFIGAPIVGKLMDHFPR 200 >11_06_0272 + 21806681-21806908,21806991-21807233,21807318-21807444, 21807822-21808036 Length = 270 Score = 28.3 bits (60), Expect = 5.0 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +2 Query: 248 ITSTLAGPTSLDISAGTGLSTFHTRIDALETRL 346 I++T A P+ +D +AGTG + + AL+ +L Sbjct: 43 ISATAAAPSGVDYAAGTGAAADDDAVAALKVKL 75 >11_01_0709 - 5821246-5821449,5821517-5821634,5821720-5821812, 5822065-5822198,5822281-5822559,5822645-5822730, 5822814-5822906,5822998-5823090,5823192-5823299, 5824034-5824060,5824538-5824766 Length = 487 Score = 27.5 bits (58), Expect = 8.7 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = -1 Query: 569 LSTTFCRVLSFSRG*WQIVYGEPLTF*QVKTAAYVV 462 L C L+F G W YG LTF V+ A+++V Sbjct: 422 LIVEICDPLAFKVGGWVTEYGNILTFATVRGASHMV 457 >03_06_0642 + 35239658-35240083,35240167-35240238,35240305-35240919, 35241253-35241435,35241604-35241663,35241733-35241936, 35242497-35242745,35243609-35243707,35243760-35243858, 35244463-35244480,35244668-35244862,35244981-35245073, 35245265-35245531,35245884-35246102 Length = 932 Score = 27.5 bits (58), Expect = 8.7 Identities = 29/116 (25%), Positives = 54/116 (46%), Gaps = 1/116 (0%) Frame = -3 Query: 561 NILSSSFVLERIVADRLWRTAYLLTSEDRGVCCVSPLPKLCSLLSRQRSE-GIEPSSLQE 385 N+LS S + + ++++ L A + +EDR + V L L + Q +E I P+ L Sbjct: 819 NLLSVSKISDYVLSNELVSMALAMVAEDRQINDV-----LEELFAEQGNEMQIRPADLYL 873 Query: 384 QRGQVLSGHQYICSRVSRASIRV*NVESPVPADMSRLVGPAKVDVMQWDAVEVFCI 217 + + L+ + + R I + V A+ + + P KV +W A +VF + Sbjct: 874 REDEELNFFEVMLRGRQRKEIVI--GYRLVDAERAIINPPDKVSRRRWSAKDVFVV 927 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,745,322 Number of Sequences: 37544 Number of extensions: 319894 Number of successful extensions: 752 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 730 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 751 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1435654836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -