BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060816.seq (599 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ010904-1|CAA09390.1| 142|Anopheles gambiae nitric oxide synth... 23 5.7 AJ973470-1|CAJ01517.1| 117|Anopheles gambiae hypothetical prote... 23 10.0 AJ697733-1|CAG26926.1| 117|Anopheles gambiae putative chemosens... 23 10.0 AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcript... 23 10.0 >AJ010904-1|CAA09390.1| 142|Anopheles gambiae nitric oxide synthase protein. Length = 142 Score = 23.4 bits (48), Expect = 5.7 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -1 Query: 167 QQWDMILSDKCDCK 126 Q+WD I S+ DCK Sbjct: 8 QEWDHIKSEMVDCK 21 >AJ973470-1|CAJ01517.1| 117|Anopheles gambiae hypothetical protein protein. Length = 117 Score = 22.6 bits (46), Expect = 10.0 Identities = 13/30 (43%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = -1 Query: 488 QVKTAAYVVLAR-CQNCVAC*AGNAQRESN 402 Q+K A V+ R C+NC A NAQ+ +N Sbjct: 68 QLKAALPEVIQRNCRNCSPQQAQNAQKLTN 97 >AJ697733-1|CAG26926.1| 117|Anopheles gambiae putative chemosensory protein CSP4 protein. Length = 117 Score = 22.6 bits (46), Expect = 10.0 Identities = 13/30 (43%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = -1 Query: 488 QVKTAAYVVLAR-CQNCVAC*AGNAQRESN 402 Q+K A V+ R C+NC A NAQ+ +N Sbjct: 68 QLKAALPEVIQRNCRNCSPQQAQNAQKLTN 97 >AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcriptase protein. Length = 1009 Score = 22.6 bits (46), Expect = 10.0 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 215 VIQKTSTASHCITSTLAGPTSLDISAGTGLSTFHTR 322 VI T SH LAG L + TFH R Sbjct: 797 VISSFRTTSHDAVCVLAGMIPLHLLLDEDSRTFHRR 832 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 619,680 Number of Sequences: 2352 Number of extensions: 12678 Number of successful extensions: 18 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58029966 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -