BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060815.seq (660 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g28390.1 68417.m04063 ADP, ATP carrier protein, mitochondrial... 65 5e-11 At3g08580.2 68416.m00996 ADP, ATP carrier protein 1, mitochondri... 60 1e-09 At3g08580.1 68416.m00995 ADP, ATP carrier protein 1, mitochondri... 60 1e-09 At5g17400.1 68418.m02041 ADP, ATP carrier protein, mitochondrial... 60 2e-09 At5g13490.1 68418.m01556 ADP, ATP carrier protein 2, mitochondri... 59 2e-09 At5g56450.1 68418.m07046 mitochondrial substrate carrier family ... 53 2e-07 At3g51870.1 68416.m05688 mitochondrial substrate carrier family ... 42 3e-04 At5g01500.1 68418.m00064 mitochondrial substrate carrier family ... 42 5e-04 At2g46320.1 68415.m05761 mitochondrial substrate carrier family ... 37 0.010 At5g09470.1 68418.m01096 mitochondrial substrate carrier family ... 36 0.024 At4g26180.1 68417.m03768 mitochondrial substrate carrier family ... 36 0.024 At3g55640.1 68416.m06182 mitochondrial substrate carrier family ... 36 0.024 At3g53940.1 68416.m05959 mitochondrial substrate carrier family ... 34 0.073 At1g14560.1 68414.m01731 mitochondrial substrate carrier family ... 34 0.073 At5g01340.1 68418.m00047 mitochondrial substrate carrier family ... 33 0.13 At4g01100.1 68417.m00148 mitochondrial substrate carrier family ... 33 0.17 At1g14140.1 68414.m01671 mitochondrial substrate carrier family ... 33 0.22 At5g48970.1 68418.m06059 mitochondrial substrate carrier family ... 32 0.29 At2g37890.1 68415.m04651 mitochondrial substrate carrier family ... 32 0.29 At1g78180.1 68414.m09110 mitochondrial substrate carrier family ... 32 0.29 At4g32400.1 68417.m04613 mitochondrial substrate carrier family ... 31 0.51 At4g27940.1 68417.m04009 mitochondrial substrate carrier family ... 31 0.51 At5g64970.1 68418.m08172 mitochondrial substrate carrier family ... 31 0.68 At1g25380.1 68414.m03150 mitochondrial substrate carrier family ... 31 0.68 At5g58970.2 68418.m07388 uncoupling protein (UCP2) identical to ... 31 0.90 At5g58970.1 68418.m07387 uncoupling protein (UCP2) identical to ... 31 0.90 At1g05530.1 68414.m00567 UDP-glucoronosyl/UDP-glucosyl transfera... 31 0.90 At3g54110.1 68416.m05982 plant uncoupling mitochondrial protein ... 30 1.2 At2g39970.1 68415.m04911 peroxisomal membrane protein (PMP36) id... 30 1.2 At5g61810.1 68418.m07756 mitochondrial substrate carrier family ... 30 1.6 At2g47490.1 68415.m05928 mitochondrial substrate carrier family ... 30 1.6 At2g43770.1 68415.m05441 transducin family protein / WD-40 repea... 30 1.6 At2g27810.2 68415.m03372 xanthine/uracil permease family protein... 30 1.6 At2g27810.1 68415.m03371 xanthine/uracil permease family protein... 30 1.6 At2g22500.1 68415.m02669 mitochondrial substrate carrier family ... 30 1.6 At1g74240.1 68414.m08598 mitochondrial substrate carrier family ... 30 1.6 At5g19760.1 68418.m02349 dicarboxylate/tricarboxylate carrier (D... 29 2.7 At3g21390.1 68416.m02700 mitochondrial substrate carrier family ... 29 2.7 At2g17270.1 68415.m01995 mitochondrial substrate carrier family ... 29 2.7 At1g79900.1 68414.m09335 mitochondrial substrate carrier family ... 29 2.7 At4g24570.1 68417.m03521 mitochondrial substrate carrier family ... 29 3.6 At3g20240.1 68416.m02564 mitochondrial substrate carrier family ... 29 3.6 At3g48850.1 68416.m05335 mitochondrial phosphate transporter, pu... 28 4.8 At2g33820.1 68415.m04149 mitochondrial substrate carrier family ... 28 4.8 At2g21040.1 68415.m02495 C2 domain-containing protein low simila... 28 4.8 At5g51050.1 68418.m06328 mitochondrial substrate carrier family ... 28 6.3 At3g48060.1 68416.m05240 bromo-adjacent homology (BAH) domain-co... 27 8.4 At3g48050.2 68416.m05239 bromo-adjacent homology (BAH) domain-co... 27 8.4 At3g48050.1 68416.m05238 bromo-adjacent homology (BAH) domain-co... 27 8.4 >At4g28390.1 68417.m04063 ADP, ATP carrier protein, mitochondrial, putative / ADP/ATP translocase, putative / adenine nucleotide translocator, putative similar to mitochondrial ADP,ATP carrier protein SP:P12857 from [Zea mays] Length = 379 Score = 64.9 bits (151), Expect = 5e-11 Identities = 34/72 (47%), Positives = 43/72 (59%) Frame = +2 Query: 290 GRVSSARRLPKTAVAPNRSVSKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFW 469 G VS+A + KTA AP V L+ + K + YKGI D F R K++G+L+ W Sbjct: 86 GGVSAA--VSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGISDCFARTVKDEGMLALW 143 Query: 470 RGNFANVIRYFP 505 RGN ANVIRYFP Sbjct: 144 RGNTANVIRYFP 155 Score = 30.7 bits (66), Expect = 0.90 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = +1 Query: 502 PDQALNFAFKDKYKQVF 552 P QALNFAFKD +K++F Sbjct: 155 PTQALNFAFKDYFKRLF 171 Score = 29.1 bits (62), Expect = 2.7 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +2 Query: 404 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIR 496 +YK + AF +I K +G S ++G AN++R Sbjct: 321 KYKSSLQAFSQIVKNEGAKSLFKGAGANILR 351 >At3g08580.2 68416.m00996 ADP, ATP carrier protein 1, mitochondrial / ADP/ATP translocase 1 / adenine nucleotide translocator 1 (ANT1) identical to SWISS-PROT:P31167 ADP,ATP carrier protein 1 (Adenine nucleotide translocator 1) [Arabidopsis thaliana] Length = 381 Score = 60.1 bits (139), Expect = 1e-09 Identities = 34/72 (47%), Positives = 41/72 (56%) Frame = +2 Query: 290 GRVSSARRLPKTAVAPNRSVSKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFW 469 G VS+A + KTA AP V L+ + K + YKGI D F R K++G S W Sbjct: 87 GGVSAA--VSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIGDCFGRTIKDEGFGSLW 144 Query: 470 RGNFANVIRYFP 505 RGN ANVIRYFP Sbjct: 145 RGNTANVIRYFP 156 Score = 31.1 bits (67), Expect = 0.68 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = +2 Query: 404 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIR 496 +YK +DAF +I K +G S ++G AN++R Sbjct: 323 KYKSSLDAFKQILKNEGAKSLFKGAGANILR 353 Score = 30.7 bits (66), Expect = 0.90 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = +1 Query: 502 PDQALNFAFKDKYKQVF 552 P QALNFAFKD +K++F Sbjct: 156 PTQALNFAFKDYFKRLF 172 >At3g08580.1 68416.m00995 ADP, ATP carrier protein 1, mitochondrial / ADP/ATP translocase 1 / adenine nucleotide translocator 1 (ANT1) identical to SWISS-PROT:P31167 ADP,ATP carrier protein 1 (Adenine nucleotide translocator 1) [Arabidopsis thaliana] Length = 381 Score = 60.1 bits (139), Expect = 1e-09 Identities = 34/72 (47%), Positives = 41/72 (56%) Frame = +2 Query: 290 GRVSSARRLPKTAVAPNRSVSKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFW 469 G VS+A + KTA AP V L+ + K + YKGI D F R K++G S W Sbjct: 87 GGVSAA--VSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIGDCFGRTIKDEGFGSLW 144 Query: 470 RGNFANVIRYFP 505 RGN ANVIRYFP Sbjct: 145 RGNTANVIRYFP 156 Score = 31.1 bits (67), Expect = 0.68 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = +2 Query: 404 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIR 496 +YK +DAF +I K +G S ++G AN++R Sbjct: 323 KYKSSLDAFKQILKNEGAKSLFKGAGANILR 353 Score = 30.7 bits (66), Expect = 0.90 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = +1 Query: 502 PDQALNFAFKDKYKQVF 552 P QALNFAFKD +K++F Sbjct: 156 PTQALNFAFKDYFKRLF 172 >At5g17400.1 68418.m02041 ADP, ATP carrier protein, mitochondrial, putative / ADP/ATP translocase, putative / adenine nucleotide translocator, putative similar to SWISS-PROT:Q09188 ADP,ATP carrier protein (ADP/ATP translocase) [Schizosaccharomyces pombe]; contains Pfam profile: PF00153 mitochondrial carrier protein Length = 306 Score = 59.7 bits (138), Expect = 2e-09 Identities = 35/69 (50%), Positives = 45/69 (65%), Gaps = 1/69 (1%) Frame = +2 Query: 302 SARRLPKTAVAPNRSVSKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGN 478 +A + K+A AP V KLLLQ Q + K + Y G+ + F RI +E+G+LSFWRGN Sbjct: 19 AAAIVAKSAAAPIERV-KLLLQNQGEMIKTGHLIRPYTGLGNCFTRIYREEGVLSFWRGN 77 Query: 479 FANVIRYFP 505 ANVIRYFP Sbjct: 78 QANVIRYFP 86 >At5g13490.1 68418.m01556 ADP, ATP carrier protein 2, mitochondrial / ADP/ATP translocase 2 / adenine nucleotide translocator 2 (ANT2) identical to SWISS-PROT:P40941 ADP,ATP carrier protein 2, mitochondrial precursor (Adenine nucleotide translocator 2) [Arabidopsis thaliana] Length = 385 Score = 59.3 bits (137), Expect = 2e-09 Identities = 33/72 (45%), Positives = 42/72 (58%) Frame = +2 Query: 290 GRVSSARRLPKTAVAPNRSVSKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFW 469 G VS+A + KTA AP V L+ + K + YKGI D F R +++G+ S W Sbjct: 91 GGVSAA--VSKTAAAPIERVKLLIQNQDEMLKAGRLTEPYKGIRDCFGRTIRDEGIGSLW 148 Query: 470 RGNFANVIRYFP 505 RGN ANVIRYFP Sbjct: 149 RGNTANVIRYFP 160 Score = 31.1 bits (67), Expect = 0.68 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +1 Query: 502 PDQALNFAFKDKYKQVFLGGVDK 570 P QALNFAFKD +K++F DK Sbjct: 160 PTQALNFAFKDYFKRLFNFKKDK 182 Score = 31.1 bits (67), Expect = 0.68 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = +2 Query: 404 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIR 496 +YK DAF +I K++G S ++G AN++R Sbjct: 327 KYKSSFDAFSQIVKKEGAKSLFKGAGANILR 357 >At5g56450.1 68418.m07046 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 330 Score = 52.8 bits (121), Expect = 2e-07 Identities = 29/67 (43%), Positives = 41/67 (61%), Gaps = 6/67 (8%) Frame = +2 Query: 323 TAVAPNRSVSKLLLQVQHVSKQIAADQ------RYKGIVDAFVRIPKEQGLLSFWRGNFA 484 T VAP +KLLLQ Q + I D+ R+KG+ D R +E+G+LS WRGN + Sbjct: 46 TIVAPIER-AKLLLQTQESNIAIVGDEGHAGKRRFKGMFDFIFRTVREEGVLSLWRGNGS 104 Query: 485 NVIRYFP 505 +V+RY+P Sbjct: 105 SVLRYYP 111 Score = 29.9 bits (64), Expect = 1.6 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = +2 Query: 407 YKGIVDAFVRIPKEQGLLSFWRGNFANVIR 496 Y+ +D + +I + +GL SF+RG +N+ R Sbjct: 278 YRSTLDCWKKIYRSEGLASFYRGALSNMFR 307 >At3g51870.1 68416.m05688 mitochondrial substrate carrier family protein peroxisomal Ca-dependent solute carrier - Oryctolagus cuniculus, EMBL:AF004161 Length = 381 Score = 42.3 bits (95), Expect = 3e-04 Identities = 21/62 (33%), Positives = 33/62 (53%) Frame = +2 Query: 320 KTAVAPNRSVSKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRY 499 KT AP + KLL+Q + + ++ G ++A I KE+G+ +W+GN VIR Sbjct: 102 KTVTAPLDRI-KLLMQTHGIRLGQQSAKKAIGFIEAITLIAKEEGVKGYWKGNLPQVIRV 160 Query: 500 FP 505 P Sbjct: 161 LP 162 Score = 28.3 bits (60), Expect = 4.8 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +2 Query: 407 YKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFP 505 YK I +AF I GL+ +RG N ++ P Sbjct: 312 YKSIPEAFAGIIDRDGLIGLYRGFLPNALKTLP 344 >At5g01500.1 68418.m00064 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 415 Score = 41.5 bits (93), Expect = 5e-04 Identities = 25/76 (32%), Positives = 39/76 (51%) Frame = +2 Query: 278 LSWAGRVSSARRLPKTAVAPNRSVSKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 457 L +AG + A K+ AP + KLL+Q V + ++ G ++A I KE+G+ Sbjct: 118 LFFAGAFAGAAA--KSVTAPLDRI-KLLMQTHGVRAGQQSAKKAIGFIEAITLIGKEEGI 174 Query: 458 LSFWRGNFANVIRYFP 505 +W+GN VIR P Sbjct: 175 KGYWKGNLPQVIRIVP 190 Score = 28.7 bits (61), Expect = 3.6 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +2 Query: 407 YKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFP 505 YK ++DAF I +G++ +RG N ++ P Sbjct: 340 YKSVLDAFSGIIAREGVVGLYRGFVPNALKSMP 372 >At2g46320.1 68415.m05761 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 361 Score = 37.1 bits (82), Expect = 0.010 Identities = 14/42 (33%), Positives = 24/42 (57%) Frame = +2 Query: 380 SKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFP 505 S + +D +YKG +D F +I +++G WRG A++ P Sbjct: 91 SASVCSDNQYKGTLDVFYKIIRQEGFSRLWRGTNASLTLAIP 132 >At5g09470.1 68418.m01096 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 337 Score = 35.9 bits (79), Expect = 0.024 Identities = 14/32 (43%), Positives = 22/32 (68%) Frame = +2 Query: 401 QRYKGIVDAFVRIPKEQGLLSFWRGNFANVIR 496 + YK +VDA RI +++G+ S WRG++ V R Sbjct: 187 RNYKSVVDAIDRIARQEGVSSLWRGSWLTVNR 218 >At4g26180.1 68417.m03768 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 325 Score = 35.9 bits (79), Expect = 0.024 Identities = 25/65 (38%), Positives = 37/65 (56%), Gaps = 1/65 (1%) Frame = +2 Query: 314 LPKTAVAPNRSVSKLLLQVQHVS-KQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANV 490 + KTAVAP + K+L Q + K+I G+V + +I K +GL+ F+RGN A+V Sbjct: 30 IAKTAVAPLERI-KILFQTRRDEFKRI-------GLVGSINKIGKTEGLMGFYRGNGASV 81 Query: 491 IRYFP 505 R P Sbjct: 82 ARIVP 86 Score = 30.3 bits (65), Expect = 1.2 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = +2 Query: 350 SKLLLQVQHVSKQIAADQR-YKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFP 505 +KL Q Q K I +Q Y+GIVD F R +E G +RG ++ FP Sbjct: 139 TKLAYQTQ--VKAIPVEQIIYRGIVDCFSRTYRESGARGLYRGVAPSLYGIFP 189 >At3g55640.1 68416.m06182 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 332 Score = 35.9 bits (79), Expect = 0.024 Identities = 22/62 (35%), Positives = 31/62 (50%) Frame = +2 Query: 320 KTAVAPNRSVSKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRY 499 KT AP ++ +L QVQ + AA R I+ RI E+GL +FW+GN + Sbjct: 49 KTCTAPLSRLT-ILFQVQGMHTNAAA-LRKPSILHEASRILNEEGLKAFWKGNLVTIAHR 106 Query: 500 FP 505 P Sbjct: 107 LP 108 >At3g53940.1 68416.m05959 mitochondrial substrate carrier family protein Length = 365 Score = 34.3 bits (75), Expect = 0.073 Identities = 24/73 (32%), Positives = 35/73 (47%) Frame = +2 Query: 287 AGRVSSARRLPKTAVAPNRSVSKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSF 466 AG ++ A KT AP ++ +L Q+Q + + AA I RI KE+G +F Sbjct: 75 AGGIAGA--FSKTCTAPLARLT-ILFQIQGMQSE-AAILSSPNIWHEASRIVKEEGFRAF 130 Query: 467 WRGNFANVIRYFP 505 W+GN V P Sbjct: 131 WKGNLVTVAHRLP 143 >At1g14560.1 68414.m01731 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 331 Score = 34.3 bits (75), Expect = 0.073 Identities = 23/68 (33%), Positives = 37/68 (54%) Frame = +2 Query: 302 SARRLPKTAVAPNRSVSKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNF 481 +A + KTAVAP + K+LLQ + D + G+ + ++ + G L F++GN Sbjct: 32 AAGAIAKTAVAPLERI-KILLQTR------TNDFKTLGVSQSLKKVLQFDGPLGFYKGNG 84 Query: 482 ANVIRYFP 505 A+VIR P Sbjct: 85 ASVIRIIP 92 >At5g01340.1 68418.m00047 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 309 Score = 33.5 bits (73), Expect = 0.13 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = +2 Query: 404 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFP 505 RYKG+V A I E+GL++ WRG ++R P Sbjct: 250 RYKGMVHAIRTIYAEEGLVALWRGLLPRLMRIPP 283 >At4g01100.1 68417.m00148 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 352 Score = 33.1 bits (72), Expect = 0.17 Identities = 25/74 (33%), Positives = 38/74 (51%) Frame = +2 Query: 284 WAGRVSSARRLPKTAVAPNRSVSKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLS 463 +AG V+ + +TAVAP + K+LLQVQ+ + +Y G V I + +GL Sbjct: 43 FAGGVAGG--VSRTAVAPLERM-KILLQVQNPH-----NIKYSGTVQGLKHIWRTEGLRG 94 Query: 464 FWRGNFANVIRYFP 505 ++GN N R P Sbjct: 95 LFKGNGTNCARIVP 108 >At1g14140.1 68414.m01671 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 305 Score = 32.7 bits (71), Expect = 0.22 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +2 Query: 404 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYF 502 RY G ++AF +I + +G+ W+G N+ R F Sbjct: 156 RYSGPIEAFTKILQSEGVKGLWKGVLPNIQRAF 188 >At5g48970.1 68418.m06059 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 339 Score = 32.3 bits (70), Expect = 0.29 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = +2 Query: 377 VSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFP 505 V ++ +Y G+V A I +E+G FWRGN ++ P Sbjct: 59 VRGNLSGASKYTGMVQATKDIFREEGFRGFWRGNVPALLMVMP 101 >At2g37890.1 68415.m04651 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 337 Score = 32.3 bits (70), Expect = 0.29 Identities = 23/73 (31%), Positives = 37/73 (50%) Frame = +2 Query: 287 AGRVSSARRLPKTAVAPNRSVSKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSF 466 AG ++ A + KT AP ++ +L Q+Q + + A R +A RI E+G +F Sbjct: 47 AGGIAGA--ISKTCTAPLARLT-ILFQLQGMQSEGAVLSRPNLRREAS-RIINEEGYRAF 102 Query: 467 WRGNFANVIRYFP 505 W+GN V+ P Sbjct: 103 WKGNLVTVVHRIP 115 >At1g78180.1 68414.m09110 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 342 Score = 32.3 bits (70), Expect = 0.29 Identities = 25/85 (29%), Positives = 39/85 (45%), Gaps = 2/85 (2%) Frame = +2 Query: 257 RSRSA-KGLSWAGRVSSARRLPKTAVAPNRSVSKLLLQ-VQHVSKQIAADQRYKGIVDAF 430 R RS G+ G +++ + L AVA VSK L ++ + + + ++ Sbjct: 32 RKRSVIGGVRRRGTMNTRKHLWAGAVAA--MVSKTFLAPLERLKLEYTVRGEQRNLLVVA 89 Query: 431 VRIPKEQGLLSFWRGNFANVIRYFP 505 I QGL FW+GN NV+R P Sbjct: 90 KSIATTQGLTGFWKGNLLNVLRTAP 114 >At4g32400.1 68417.m04613 mitochondrial substrate carrier family protein Length = 392 Score = 31.5 bits (68), Expect = 0.51 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = +2 Query: 407 YKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFP 505 YKGI DAF++I +E+G +RG ++I P Sbjct: 239 YKGIFDAFLKIIREEGPTELYRGLAPSLIGVVP 271 Score = 28.7 bits (61), Expect = 3.6 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 1/69 (1%) Frame = +2 Query: 302 SARRLPKTAVAPNRSVSKLLLQ-VQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGN 478 S RRL AVA +VS+ ++ ++ + + + F I K +G +RGN Sbjct: 110 SLRRLLSGAVAG--AVSRTVVAPLETIRTHLMVGSGGNSSTEVFSDIMKHEGWTGLFRGN 167 Query: 479 FANVIRYFP 505 NVIR P Sbjct: 168 LVNVIRVAP 176 Score = 27.5 bits (58), Expect = 8.4 Identities = 20/69 (28%), Positives = 36/69 (52%) Frame = +2 Query: 299 SSARRLPKTAVAPNRSVSKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGN 478 S A L TA P V++ +QV VS ++ YK ++ A V I + +G+L +++G Sbjct: 306 SLAGALSSTATFP-LEVARKHMQVGAVSGRVV----YKNMLHALVTILEHEGILGWYKGL 360 Query: 479 FANVIRYFP 505 + ++ P Sbjct: 361 GPSCLKLVP 369 >At4g27940.1 68417.m04009 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 413 Score = 31.5 bits (68), Expect = 0.51 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +2 Query: 404 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFP 505 +YKG D F +I +++GL WRG A + P Sbjct: 145 QYKGTFDVFTKIIRQEGLGRLWRGTNAGLALAVP 178 >At5g64970.1 68418.m08172 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 428 Score = 31.1 bits (67), Expect = 0.68 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +2 Query: 416 IVDAFVRIPKEQGLLSFWRGNFANVIRYFP 505 +++ RI +G+ FW+GN N++R P Sbjct: 168 LLELIQRIATNEGIRGFWKGNLVNILRTAP 197 >At1g25380.1 68414.m03150 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 363 Score = 31.1 bits (67), Expect = 0.68 Identities = 10/37 (27%), Positives = 22/37 (59%) Frame = +2 Query: 395 ADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFP 505 A+ +Y G++D ++ + +G+ +RG N++R P Sbjct: 254 AETKYSGVIDCITKVFRSEGIPGLYRGCATNLLRTTP 290 Score = 30.7 bits (66), Expect = 0.90 Identities = 23/73 (31%), Positives = 34/73 (46%) Frame = +2 Query: 287 AGRVSSARRLPKTAVAPNRSVSKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSF 466 AG ++A + T V P V K LQV + + A+ QR I+ + I KE+G Sbjct: 21 AGAGATAGAIAATFVCP-LDVIKTRLQVLGLPEAPASGQRGGVIITSLKNIIKEEGYRGM 79 Query: 467 WRGNFANVIRYFP 505 +RG +I P Sbjct: 80 YRGLSPTIIALLP 92 >At5g58970.2 68418.m07388 uncoupling protein (UCP2) identical to uncoupling protein GI:4063007 from [Arabidopsis thaliana] Length = 272 Score = 30.7 bits (66), Expect = 0.90 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +2 Query: 401 QRYKGIVDAFVRIPKEQGLLSFWRGNFANVIR 496 +RY G VDA+ I K +G+ + W G N+ R Sbjct: 156 RRYAGAVDAYFTIVKLEGVSALWTGLGPNIAR 187 >At5g58970.1 68418.m07387 uncoupling protein (UCP2) identical to uncoupling protein GI:4063007 from [Arabidopsis thaliana] Length = 305 Score = 30.7 bits (66), Expect = 0.90 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +2 Query: 401 QRYKGIVDAFVRIPKEQGLLSFWRGNFANVIR 496 +RY G VDA+ I K +G+ + W G N+ R Sbjct: 156 RRYAGAVDAYFTIVKLEGVSALWTGLGPNIAR 187 >At1g05530.1 68414.m00567 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 455 Score = 30.7 bits (66), Expect = 0.90 Identities = 16/34 (47%), Positives = 19/34 (55%) Frame = -1 Query: 423 STIPL*RWSAAICLLTCCTWSSSFDTLRLGATAV 322 S I + R A C LT C WSSS ++L LG V Sbjct: 336 SQIEVLRHRAIGCFLTHCGWSSSLESLVLGVPVV 369 >At3g54110.1 68416.m05982 plant uncoupling mitochondrial protein (PUMP) identical to plant uncoupling mitochondrial protein [Arabidopsis thaliana] GI:3115108 Length = 306 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +2 Query: 380 SKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFAN 487 S+ + YKG +D FV+ K G ++F++G N Sbjct: 240 SRMMGDSGAYKGTIDCFVKTLKSDGPMAFYKGFIPN 275 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +2 Query: 395 ADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIR 496 A +RY G ++A+ I +++G+ + W G NV R Sbjct: 152 APRRYSGALNAYSTIVRQEGVRALWTGLGPNVAR 185 Score = 27.9 bits (59), Expect = 6.3 Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 3/45 (6%) Frame = +2 Query: 350 SKLLLQVQHVSKQIAAD---QRYKGIVDAFVRIPKEQGLLSFWRG 475 +K+ LQ+Q +A D +Y+G++ I +E+GL S W+G Sbjct: 35 AKVRLQLQ--KSALAGDVTLPKYRGLLGTVGTIAREEGLRSLWKG 77 >At2g39970.1 68415.m04911 peroxisomal membrane protein (PMP36) identical to 36kDa-peroxisomal membrane protein (PMP36) GI:15146342 from [Arabidopsis thaliana] Length = 331 Score = 30.3 bits (65), Expect = 1.2 Identities = 10/32 (31%), Positives = 22/32 (68%) Frame = +2 Query: 401 QRYKGIVDAFVRIPKEQGLLSFWRGNFANVIR 496 Q+YKG +DA +++ + +GL F++G +++ Sbjct: 271 QQYKGTLDAILKMIRYEGLYGFYKGMSTKIVQ 302 >At5g61810.1 68418.m07756 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier, Oryctolagus cuniculus,GI:2352427; contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 478 Score = 29.9 bits (64), Expect = 1.6 Identities = 25/73 (34%), Positives = 37/73 (50%) Frame = +2 Query: 287 AGRVSSARRLPKTAVAPNRSVSKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSF 466 AG ++ A + +TA AP + K+ LQVQ + G+V +I +E LL F Sbjct: 210 AGGIAGA--VSRTATAPLDRL-KVALQVQRTNL---------GVVPTIKKIWREDKLLGF 257 Query: 467 WRGNFANVIRYFP 505 +RGN NV + P Sbjct: 258 FRGNGLNVAKVAP 270 >At2g47490.1 68415.m05928 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 312 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/69 (27%), Positives = 32/69 (46%) Frame = +2 Query: 299 SSARRLPKTAVAPNRSVSKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGN 478 S A+ T P+ V L + H S ++RY G+ D ++ ++ G F+RG Sbjct: 221 SIAKIFASTLTYPHEVVRARLQEQGHHS-----EKRYSGVRDCIKKVFEKDGFPGFYRGC 275 Query: 479 FANVIRYFP 505 N++R P Sbjct: 276 ATNLLRTTP 284 >At2g43770.1 68415.m05441 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to U5 snRNP-specific 40 kDa protein (GI:3820594) [Homo sapiens] Length = 343 Score = 29.9 bits (64), Expect = 1.6 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 4/42 (9%) Frame = +1 Query: 472 W*LRQRH--QVLPD--QALNFAFKDKYKQVFLGGVDKKTQFW 585 W +RQR Q PD Q +F D ++F GGVD + W Sbjct: 166 WDMRQRGAIQTFPDKYQITAVSFSDAADKIFTGGVDNDVKVW 207 >At2g27810.2 68415.m03372 xanthine/uracil permease family protein contains Pfam profile: PF00860 permease family Length = 660 Score = 29.9 bits (64), Expect = 1.6 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = +1 Query: 301 FRPPSSKDRRSTQSERVKAAAPSTARQQADRRRPALQGYRRRLRPHP 441 FRP S + +T S + + P A+QQ +P L+ + RLRP P Sbjct: 35 FRPKFSGETTATDSSSGQLSLPVRAKQQ--ETQPDLEAGQTRLRPPP 79 >At2g27810.1 68415.m03371 xanthine/uracil permease family protein contains Pfam profile: PF00860 permease family Length = 709 Score = 29.9 bits (64), Expect = 1.6 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = +1 Query: 301 FRPPSSKDRRSTQSERVKAAAPSTARQQADRRRPALQGYRRRLRPHP 441 FRP S + +T S + + P A+QQ +P L+ + RLRP P Sbjct: 35 FRPKFSGETTATDSSSGQLSLPVRAKQQ--ETQPDLEAGQTRLRPPP 79 >At2g22500.1 68415.m02669 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 313 Score = 29.9 bits (64), Expect = 1.6 Identities = 13/47 (27%), Positives = 28/47 (59%), Gaps = 1/47 (2%) Frame = +2 Query: 359 LLQVQHVSKQIAADQR-YKGIVDAFVRIPKEQGLLSFWRGNFANVIR 496 ++++Q + D+R YK ++DA ++ + +G+ S WRG+ + R Sbjct: 144 MVRMQADGRLPLTDRRNYKSVLDAITQMIRGEGVTSLWRGSSLTINR 190 >At1g74240.1 68414.m08598 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 364 Score = 29.9 bits (64), Expect = 1.6 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = +2 Query: 404 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFP 505 +YKG +DA +I +++G F+RG+ V+ Y P Sbjct: 287 KYKGWLDAVGQIWRKEGPQGFFRGSVPRVMWYLP 320 >At5g19760.1 68418.m02349 dicarboxylate/tricarboxylate carrier (DTC) identical to dicarboxylate/tricarboxylate carrier [Arabidopsis thaliana] GI:19913113 Length = 298 Score = 29.1 bits (62), Expect = 2.7 Identities = 21/90 (23%), Positives = 42/90 (46%) Frame = +2 Query: 227 ETKMSKPSPIRSRSAKGLSWAGRVSSARRLPKTAVAPNRSVSKLLLQVQHVSKQIAADQR 406 E+ KP P+ ++ GL+ AG + + V ++ + +Q + + +A + Sbjct: 96 ESNDGKPLPLYQKALCGLT-AGAIGAC-------VGSPADLALIRMQADN-TLPLAQRRN 146 Query: 407 YKGIVDAFVRIPKEQGLLSFWRGNFANVIR 496 Y A RI ++G+L+ W+G V+R Sbjct: 147 YTNAFHALTRISADEGVLALWKGCGPTVVR 176 >At3g21390.1 68416.m02700 mitochondrial substrate carrier family protein Length = 335 Score = 29.1 bits (62), Expect = 2.7 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +2 Query: 404 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFP 505 +Y G+ I +E+GL FWRGN ++ P Sbjct: 63 KYNGLFRTTKDIFREEGLSGFWRGNVPALLMVVP 96 >At2g17270.1 68415.m01995 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 309 Score = 29.1 bits (62), Expect = 2.7 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +2 Query: 410 KGIVDAFVRIPKEQGLLSFWRGNFANVIRYFP 505 KG++D F R+ + +GL F RG F R P Sbjct: 147 KGLLDGFPRVYRSEGLAGFHRGLFPLWCRNLP 178 >At1g79900.1 68414.m09335 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 296 Score = 29.1 bits (62), Expect = 2.7 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +2 Query: 407 YKGIVDAFVRIPKEQGLLSFWRGNFANVIRYF 502 Y+GI D F + K++G WRG V R F Sbjct: 235 YEGIADCFRKSVKQEGYTVLWRGLGTAVARAF 266 >At4g24570.1 68417.m03521 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 313 Score = 28.7 bits (61), Expect = 3.6 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +2 Query: 389 IAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIR 496 +A + Y G+ DA + K +G+ S WRG+ + R Sbjct: 162 LAQRRNYAGVGDAIRSMVKGEGVTSLWRGSALTINR 197 >At3g20240.1 68416.m02564 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier proteins Length = 348 Score = 28.7 bits (61), Expect = 3.6 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +2 Query: 410 KGIVDAFVRIPKEQGLLSFWRGNFANVIRYFP 505 + I +F+ + ++QG W GN N+IR P Sbjct: 83 RSIPGSFLEVVQKQGWQGLWAGNEINMIRIIP 114 >At3g48850.1 68416.m05335 mitochondrial phosphate transporter, putative similar to mitochondrial phosphate transporter GI:3318617 from [Arabidopsis thaliana] Length = 363 Score = 28.3 bits (60), Expect = 4.8 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = +2 Query: 404 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIRY 499 +YK I AF KEQGL F RG ++ Y Sbjct: 101 KYKNITSAFKTTIKEQGLKGFTRGWSPTLLGY 132 >At2g33820.1 68415.m04149 mitochondrial substrate carrier family protein (BAC1) contains Pfam profile: PF00153 mitochondrial carrier protein Length = 311 Score = 28.3 bits (60), Expect = 4.8 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = +2 Query: 353 KLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIR 496 K +Q+Q + +RY +D V+ K G+ +RG A ++R Sbjct: 138 KCRMQIQGTDSLVPNFRRYNSPLDCAVQTVKNDGVTGIFRGGSATLLR 185 >At2g21040.1 68415.m02495 C2 domain-containing protein low similarity to phloem protein [Cucurbita maxima] GI:4164541; contains Pfam profile PF00168: C2 domain Length = 261 Score = 28.3 bits (60), Expect = 4.8 Identities = 21/62 (33%), Positives = 28/62 (45%), Gaps = 6/62 (9%) Frame = +1 Query: 376 RQQADRRRPALQGYRRRLRPHPQGAGSPFILAW*LRQRHQ------VLPDQALNFAFKDK 537 RQ+A R+ L G R P QGAGS + W L+ + + L +F F D Sbjct: 197 RQEAVRQGAGLSGSRFVKEPVRQGAGSSGVGVWPLKSQGRPSDLRFFLKSTFSSFKFHDH 256 Query: 538 YK 543 YK Sbjct: 257 YK 258 >At5g51050.1 68418.m06328 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier [Oryctolagus cuniculus] GI:2352427; contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 487 Score = 27.9 bits (59), Expect = 6.3 Identities = 23/73 (31%), Positives = 37/73 (50%) Frame = +2 Query: 287 AGRVSSARRLPKTAVAPNRSVSKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSF 466 AG ++ A +TA AP + K+LLQ+Q +I +A I K+ G+ F Sbjct: 214 AGGIAGAAS--RTATAPLDRL-KVLLQIQKTDARIR---------EAIKLIWKQGGVRGF 261 Query: 467 WRGNFANVIRYFP 505 +RGN N+++ P Sbjct: 262 FRGNGLNIVKVAP 274 >At3g48060.1 68416.m05240 bromo-adjacent homology (BAH) domain-containing protein contains Pfam profile PF01426: BAH domain Length = 1611 Score = 27.5 bits (58), Expect = 8.4 Identities = 16/50 (32%), Positives = 26/50 (52%) Frame = +2 Query: 257 RSRSAKGLSWAGRVSSARRLPKTAVAPNRSVSKLLLQVQHVSKQIAADQR 406 +S S +G+SW GR+S R + N++ S L H SK ++ Q+ Sbjct: 416 KSGSNQGVSWPGRLSHGGRHSGGSAEANKTSSSHL----HASKSVSVKQQ 461 >At3g48050.2 68416.m05239 bromo-adjacent homology (BAH) domain-containing protein contains Pfam profile PF01426: BAH domain Length = 1613 Score = 27.5 bits (58), Expect = 8.4 Identities = 16/50 (32%), Positives = 26/50 (52%) Frame = +2 Query: 257 RSRSAKGLSWAGRVSSARRLPKTAVAPNRSVSKLLLQVQHVSKQIAADQR 406 +S S +G+SW GR+S R + N++ S L H SK ++ Q+ Sbjct: 416 KSGSNQGVSWPGRLSHGGRHSGGSAEANKTSSSHL----HASKSVSVKQQ 461 >At3g48050.1 68416.m05238 bromo-adjacent homology (BAH) domain-containing protein contains Pfam profile PF01426: BAH domain Length = 1613 Score = 27.5 bits (58), Expect = 8.4 Identities = 16/50 (32%), Positives = 26/50 (52%) Frame = +2 Query: 257 RSRSAKGLSWAGRVSSARRLPKTAVAPNRSVSKLLLQVQHVSKQIAADQR 406 +S S +G+SW GR+S R + N++ S L H SK ++ Q+ Sbjct: 416 KSGSNQGVSWPGRLSHGGRHSGGSAEANKTSSSHL----HASKSVSVKQQ 461 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,013,697 Number of Sequences: 28952 Number of extensions: 303613 Number of successful extensions: 921 Number of sequences better than 10.0: 49 Number of HSP's better than 10.0 without gapping: 846 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 920 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1383534864 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -