BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060813.seq (631 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory recept... 23 2.1 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 22 3.7 >AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory receptor candidate 34 protein. Length = 324 Score = 23.0 bits (47), Expect = 2.1 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -2 Query: 588 SGLTVWWFSGIHFVYSYDELFDTEGERSK 502 S L + +S +HFV D+LF E+SK Sbjct: 203 SFLLIISYSTLHFVNYIDDLFFFRFEKSK 231 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 22.2 bits (45), Expect = 3.7 Identities = 9/31 (29%), Positives = 12/31 (38%) Frame = -1 Query: 631 IFLMYEILPSGFPQIWAHCMVVQWNPFCLLL 539 +FL E PQ W QW + L+ Sbjct: 180 VFLFEEKQVQSMPQCWIDLQTWQWKVYITLV 210 Score = 21.0 bits (42), Expect = 8.5 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +1 Query: 376 QRFHQEHDHRNLS 414 + FH+EHD R S Sbjct: 260 RHFHEEHDTRRAS 272 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,959 Number of Sequences: 336 Number of extensions: 3175 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16188355 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -