BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060813.seq (631 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18076| Best HMM Match : GTP_EFTU (HMM E-Value=0.018) 97 1e-20 SB_50386| Best HMM Match : GTP_EFTU (HMM E-Value=1.6e-09) 91 9e-19 SB_51711| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0) 84 8e-17 SB_8918| Best HMM Match : GTP_EFTU (HMM E-Value=1.09301e-43) 81 6e-16 SB_37222| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) 51 7e-07 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 50 1e-06 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 49 4e-06 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_5107| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_9174| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_10507| Best HMM Match : 7tm_1 (HMM E-Value=7.9e-09) 47 1e-05 SB_39375| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_15537| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_9854| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_2747| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 46 2e-05 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) 46 2e-05 SB_30732| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 46 3e-05 SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_29704| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 46 3e-05 SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_42404| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_27248| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_16924| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 45 4e-05 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 45 4e-05 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_52165| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_32855| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_23309| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_22515| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_9177| Best HMM Match : PPI_Ypi1 (HMM E-Value=1.9) 45 4e-05 SB_2728| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) 45 4e-05 SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) 45 4e-05 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 45 6e-05 SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) 45 6e-05 SB_53321| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_47580| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_36834| Best HMM Match : Rap_GAP (HMM E-Value=0.00045) 45 6e-05 SB_36586| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_34241| Best HMM Match : RuvA_C (HMM E-Value=1.5) 45 6e-05 SB_32720| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_25872| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_21311| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_17014| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_6342| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_5539| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.033) 45 6e-05 SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_3601| Best HMM Match : DUF765 (HMM E-Value=3.9) 45 6e-05 SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_1971| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_1736| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 44 8e-05 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 44 8e-05 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_43468| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_42272| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_33340| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_22418| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_18474| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_17505| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) 44 8e-05 SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_16113| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_16044| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_15081| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_14354| Best HMM Match : TEP1_N (HMM E-Value=4.1) 44 8e-05 SB_14019| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_7770| Best HMM Match : Aldolase_II (HMM E-Value=2.6e-12) 44 8e-05 SB_5594| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_261| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 44 1e-04 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 44 1e-04 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 44 1e-04 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 44 1e-04 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 44 1e-04 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 44 1e-04 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 44 1e-04 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 44 1e-04 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 44 1e-04 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 44 1e-04 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 44 1e-04 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 44 1e-04 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 44 1e-04 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 44 1e-04 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 44 1e-04 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 44 1e-04 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 44 1e-04 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 44 1e-04 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 44 1e-04 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 44 1e-04 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 44 1e-04 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 44 1e-04 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 44 1e-04 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 44 1e-04 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 44 1e-04 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 44 1e-04 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 44 1e-04 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 44 1e-04 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 44 1e-04 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_58237| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_56549| Best HMM Match : Spermine_synth (HMM E-Value=1.5e-29) 44 1e-04 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_55086| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 44 1e-04 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_54502| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_54383| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_54347| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_53245| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_52926| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_52633| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_51470| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_51469| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_51374| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_50670| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_50614| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_49267| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_49082| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_48925| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_48900| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_48334| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_48240| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_47996| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_47825| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_47774| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_47610| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_47576| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_47430| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_47128| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_47127| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_46791| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_46688| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_46663| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_46485| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) 44 1e-04 SB_46157| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_46094| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_45961| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_45949| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_45308| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_44850| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_44783| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_44611| Best HMM Match : DUF765 (HMM E-Value=2.6) 44 1e-04 SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) 44 1e-04 SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_43717| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 44 1e-04 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_43349| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_43046| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_43000| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 44 1e-04 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_42545| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_42492| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_42248| Best HMM Match : Keratin_B2 (HMM E-Value=4.4) 44 1e-04 SB_42077| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_41735| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_41531| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_41224| Best HMM Match : DUF765 (HMM E-Value=3.5) 44 1e-04 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_40987| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_40947| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_40885| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_40734| Best HMM Match : DUF765 (HMM E-Value=0.42) 44 1e-04 SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_39977| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_39848| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_39773| Best HMM Match : DUF765 (HMM E-Value=4.1) 44 1e-04 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_39410| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_39409| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_39278| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_39260| Best HMM Match : DUF765 (HMM E-Value=9.6) 44 1e-04 SB_39012| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_38978| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_38949| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_38869| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_38642| Best HMM Match : IF4E (HMM E-Value=9.7e-12) 44 1e-04 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_38625| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_38487| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_37910| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_37896| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_37889| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_37747| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 >SB_18076| Best HMM Match : GTP_EFTU (HMM E-Value=0.018) Length = 106 Score = 97.1 bits (231), Expect = 1e-20 Identities = 44/49 (89%), Positives = 46/49 (93%) Frame = +1 Query: 94 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEM 240 M KEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKE+ E+ Sbjct: 1 MPKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKESSEV 49 >SB_50386| Best HMM Match : GTP_EFTU (HMM E-Value=1.6e-09) Length = 123 Score = 90.6 bits (215), Expect = 9e-19 Identities = 39/65 (60%), Positives = 50/65 (76%) Frame = +2 Query: 308 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 487 +D+ L +F+T +T++DAPGH+DFI NMITG +QAD A+L+V A TGEFEAG GQ Sbjct: 1 MDVGLTRFQTKNKVITLMDAPGHKDFIPNMITGAAQADVAILVVDAITGEFEAGFESGGQ 60 Query: 488 TREHA 502 TREHA Sbjct: 61 TREHA 65 >SB_51711| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0) Length = 322 Score = 84.2 bits (199), Expect = 8e-17 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = +2 Query: 299 GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQ 415 GITIDIALWKFET KYYVT+IDAPGHRDFIKNMITGTSQ Sbjct: 22 GITIDIALWKFETLKYYVTVIDAPGHRDFIKNMITGTSQ 60 Score = 33.9 bits (74), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +3 Query: 255 KYAWVLDKLKAERE 296 KYAWVLDKLKAERE Sbjct: 7 KYAWVLDKLKAERE 20 >SB_8918| Best HMM Match : GTP_EFTU (HMM E-Value=1.09301e-43) Length = 547 Score = 81.4 bits (192), Expect = 6e-16 Identities = 33/68 (48%), Positives = 48/68 (70%) Frame = +2 Query: 299 GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISK 478 G T+++ F+T + T++DAPGH+ F+ NMI+G +QAD VL+++A GEFE G + Sbjct: 207 GNTVEVGRAAFDTDTKHFTLLDAPGHKSFVPNMISGATQADLGVLVISARKGEFETGFER 266 Query: 479 NGQTREHA 502 GQTREHA Sbjct: 267 GGQTREHA 274 Score = 35.1 bits (77), Expect = 0.047 Identities = 15/34 (44%), Positives = 24/34 (70%) Frame = +1 Query: 514 TLGVKQLIVGVNKMDSTEPPYSEPRFEEIQKEVS 615 T GVK L++ VNKMD ++E R+EEI+ +++ Sbjct: 279 TAGVKHLVILVNKMDDPTVKWNEERYEEIKVKLT 312 Score = 32.3 bits (70), Expect = 0.33 Identities = 12/23 (52%), Positives = 18/23 (78%) Frame = +1 Query: 178 YKCGGIDKRTIEKFEKEAQEMGK 246 Y G +DKRT+EK+E+EA+E + Sbjct: 166 YLTGQVDKRTLEKYEREAKEKNR 188 >SB_37222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 51.6 bits (118), Expect = 5e-07 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = -1 Query: 88 VSHGLQTACNIRACSPGDPLVLERPPPRW 2 V GL+ C +CSPGDPLVLERPPPRW Sbjct: 27 VPQGLRKLCESNSCSPGDPLVLERPPPRW 55 >SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) Length = 214 Score = 51.2 bits (117), Expect = 7e-07 Identities = 19/28 (67%), Positives = 22/28 (78%) Frame = -1 Query: 85 SHGLQTACNIRACSPGDPLVLERPPPRW 2 +H +Q C +CSPGDPLVLERPPPRW Sbjct: 180 AHEVQDLCKSNSCSPGDPLVLERPPPRW 207 >SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) Length = 725 Score = 50.4 bits (115), Expect = 1e-06 Identities = 19/24 (79%), Positives = 21/24 (87%) Frame = -1 Query: 73 QTACNIRACSPGDPLVLERPPPRW 2 Q AC+ +CSPGDPLVLERPPPRW Sbjct: 187 QPACSSNSCSPGDPLVLERPPPRW 210 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 48.8 bits (111), Expect = 4e-06 Identities = 22/36 (61%), Positives = 26/36 (72%) Frame = -1 Query: 109 SFPCPFLVSHGLQTACNIRACSPGDPLVLERPPPRW 2 +F F + + LQ A N +CSPGDPLVLERPPPRW Sbjct: 648 AFQYIFAILNSLQLASN--SCSPGDPLVLERPPPRW 681 >SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 48.4 bits (110), Expect = 5e-06 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = -1 Query: 73 QTACNIRACSPGDPLVLERPPPRW 2 ++AC +CSPGDPLVLERPPPRW Sbjct: 15 RSACPSNSCSPGDPLVLERPPPRW 38 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 48.0 bits (109), Expect = 6e-06 Identities = 20/32 (62%), Positives = 24/32 (75%) Frame = -1 Query: 97 PFLVSHGLQTACNIRACSPGDPLVLERPPPRW 2 P ++ G + A N +CSPGDPLVLERPPPRW Sbjct: 43 PAFLAEGFRVASN--SCSPGDPLVLERPPPRW 72 >SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 48.0 bits (109), Expect = 6e-06 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = -1 Query: 79 GLQTACNIRACSPGDPLVLERPPPRW 2 G QTA N +CSPGDPLVLERPPPRW Sbjct: 16 GSQTASN--SCSPGDPLVLERPPPRW 39 >SB_5107| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 48.0 bits (109), Expect = 6e-06 Identities = 19/31 (61%), Positives = 21/31 (67%) Frame = -1 Query: 94 FLVSHGLQTACNIRACSPGDPLVLERPPPRW 2 F GL + +CSPGDPLVLERPPPRW Sbjct: 3 FTTHFGLHSQTTSNSCSPGDPLVLERPPPRW 33 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 47.6 bits (108), Expect = 8e-06 Identities = 19/25 (76%), Positives = 20/25 (80%) Frame = -1 Query: 76 LQTACNIRACSPGDPLVLERPPPRW 2 L TA +CSPGDPLVLERPPPRW Sbjct: 11 LPTALTSNSCSPGDPLVLERPPPRW 35 >SB_9174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 47.6 bits (108), Expect = 8e-06 Identities = 19/31 (61%), Positives = 23/31 (74%), Gaps = 1/31 (3%) Frame = -1 Query: 91 LVSHGLQT-ACNIRACSPGDPLVLERPPPRW 2 L+S ++ C +CSPGDPLVLERPPPRW Sbjct: 8 LISANIENKCCRSNSCSPGDPLVLERPPPRW 38 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 47.2 bits (107), Expect = 1e-05 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -1 Query: 64 CNIRACSPGDPLVLERPPPRW 2 C+ +CSPGDPLVLERPPPRW Sbjct: 2 CSSNSCSPGDPLVLERPPPRW 22 >SB_10507| Best HMM Match : 7tm_1 (HMM E-Value=7.9e-09) Length = 386 Score = 47.2 bits (107), Expect = 1e-05 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -1 Query: 70 TACNIRACSPGDPLVLERPPPRW 2 T N++A SPGDPLVLERPPPRW Sbjct: 259 TGSNVKALSPGDPLVLERPPPRW 281 >SB_39375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 47.2 bits (107), Expect = 1e-05 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 1/32 (3%) Frame = -1 Query: 94 FLVSHGLQTAC-NIRACSPGDPLVLERPPPRW 2 FL + L C + +CSPGDPLVLERPPPRW Sbjct: 15 FLCNEDLARTCFSSNSCSPGDPLVLERPPPRW 46 >SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 47.2 bits (107), Expect = 1e-05 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = -1 Query: 94 FLVSHGLQTACNIRACSPGDPLVLERPPPRW 2 FL+ + + A N +CSPGDPLVLERPPPRW Sbjct: 3 FLIPYFIMLASN--SCSPGDPLVLERPPPRW 31 >SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 46.8 bits (106), Expect = 1e-05 Identities = 18/27 (66%), Positives = 20/27 (74%) Frame = -1 Query: 82 HGLQTACNIRACSPGDPLVLERPPPRW 2 H A + +CSPGDPLVLERPPPRW Sbjct: 17 HAKNDALSSNSCSPGDPLVLERPPPRW 43 >SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 46.8 bits (106), Expect = 1e-05 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = -1 Query: 76 LQTACNIRACSPGDPLVLERPPPRW 2 +QT +CSPGDPLVLERPPPRW Sbjct: 2 IQTGLPSNSCSPGDPLVLERPPPRW 26 >SB_15537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 46.8 bits (106), Expect = 1e-05 Identities = 22/32 (68%), Positives = 24/32 (75%) Frame = -1 Query: 97 PFLVSHGLQTACNIRACSPGDPLVLERPPPRW 2 PF V+ GL N +CSPGDPLVLERPPPRW Sbjct: 16 PFCVN-GLSPGSN--SCSPGDPLVLERPPPRW 44 >SB_9854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 46.8 bits (106), Expect = 1e-05 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = -1 Query: 103 PCPFLVSHGLQTACNIRACSPGDPLVLERPPPRW 2 P P L G A N +CSPGDPLVLERPPPRW Sbjct: 7 PSPPLKKPGYGPASN--SCSPGDPLVLERPPPRW 38 >SB_2747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 46.8 bits (106), Expect = 1e-05 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -1 Query: 64 CNIRACSPGDPLVLERPPPRW 2 C +CSPGDPLVLERPPPRW Sbjct: 37 CTSNSCSPGDPLVLERPPPRW 57 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 46.4 bits (105), Expect = 2e-05 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = -1 Query: 79 GLQTACNIRACSPGDPLVLERPPPRW 2 GL T N +CSPGDPLVLERPPPRW Sbjct: 2 GLSTQSN--SCSPGDPLVLERPPPRW 25 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 46.4 bits (105), Expect = 2e-05 Identities = 18/31 (58%), Positives = 23/31 (74%) Frame = -1 Query: 94 FLVSHGLQTACNIRACSPGDPLVLERPPPRW 2 ++ +H + A +CSPGDPLVLERPPPRW Sbjct: 471 YIQAHPILEAGASNSCSPGDPLVLERPPPRW 501 >SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 46.4 bits (105), Expect = 2e-05 Identities = 18/24 (75%), Positives = 19/24 (79%) Frame = -1 Query: 73 QTACNIRACSPGDPLVLERPPPRW 2 QT +CSPGDPLVLERPPPRW Sbjct: 19 QTRVTSNSCSPGDPLVLERPPPRW 42 >SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) Length = 213 Score = 46.4 bits (105), Expect = 2e-05 Identities = 19/33 (57%), Positives = 22/33 (66%) Frame = -1 Query: 100 CPFLVSHGLQTACNIRACSPGDPLVLERPPPRW 2 C V+ L + +CSPGDPLVLERPPPRW Sbjct: 104 CVSDVTRALVSKAESNSCSPGDPLVLERPPPRW 136 >SB_30732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 46.4 bits (105), Expect = 2e-05 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -1 Query: 70 TACNIRACSPGDPLVLERPPPRW 2 TA +CSPGDPLVLERPPPRW Sbjct: 69 TATESNSCSPGDPLVLERPPPRW 91 >SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 46.4 bits (105), Expect = 2e-05 Identities = 19/30 (63%), Positives = 22/30 (73%) Frame = -1 Query: 91 LVSHGLQTACNIRACSPGDPLVLERPPPRW 2 L+S + A +CSPGDPLVLERPPPRW Sbjct: 8 LISANIANAKVSNSCSPGDPLVLERPPPRW 37 >SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 46.4 bits (105), Expect = 2e-05 Identities = 19/32 (59%), Positives = 24/32 (75%) Frame = -1 Query: 97 PFLVSHGLQTACNIRACSPGDPLVLERPPPRW 2 P L++H ++ +CSPGDPLVLERPPPRW Sbjct: 2 PSLMAH--ESGLTSNSCSPGDPLVLERPPPRW 31 >SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 46.0 bits (104), Expect = 3e-05 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -1 Query: 64 CNIRACSPGDPLVLERPPPRW 2 C +CSPGDPLVLERPPPRW Sbjct: 18 CASNSCSPGDPLVLERPPPRW 38 >SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/34 (55%), Positives = 20/34 (58%) Frame = -1 Query: 103 PCPFLVSHGLQTACNIRACSPGDPLVLERPPPRW 2 P P A +CSPGDPLVLERPPPRW Sbjct: 9 PFPLAAVERPSVASQSNSCSPGDPLVLERPPPRW 42 >SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = -1 Query: 85 SHGLQTACNIRACSPGDPLVLERPPPRW 2 S+GL +CSPGDPLVLERPPPRW Sbjct: 8 SYGLIRPVLSNSCSPGDPLVLERPPPRW 35 >SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) Length = 332 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/30 (66%), Positives = 24/30 (80%), Gaps = 2/30 (6%) Frame = -1 Query: 85 SHGLQTACNI--RACSPGDPLVLERPPPRW 2 S+ L+ + NI +CSPGDPLVLERPPPRW Sbjct: 12 SYFLRNSSNISSNSCSPGDPLVLERPPPRW 41 >SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/25 (80%), Positives = 21/25 (84%) Frame = -1 Query: 76 LQTACNIRACSPGDPLVLERPPPRW 2 LQ A N +CSPGDPLVLERPPPRW Sbjct: 23 LQAASN--SCSPGDPLVLERPPPRW 45 >SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/30 (66%), Positives = 22/30 (73%), Gaps = 3/30 (10%) Frame = -1 Query: 82 HGLQTACNI---RACSPGDPLVLERPPPRW 2 HGLQ + +CSPGDPLVLERPPPRW Sbjct: 28 HGLQGEHRVLTSNSCSPGDPLVLERPPPRW 57 >SB_29704| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 46.0 bits (104), Expect = 3e-05 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -1 Query: 73 QTACNIRACSPGDPLVLERPPPRW 2 QT + +CSPGDPLVLERPPPRW Sbjct: 18 QTKQSSNSCSPGDPLVLERPPPRW 41 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 45.6 bits (103), Expect = 3e-05 Identities = 19/26 (73%), Positives = 21/26 (80%) Frame = -1 Query: 79 GLQTACNIRACSPGDPLVLERPPPRW 2 G+ T N +CSPGDPLVLERPPPRW Sbjct: 5 GITTTSN--SCSPGDPLVLERPPPRW 28 >SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 45.6 bits (103), Expect = 3e-05 Identities = 19/30 (63%), Positives = 23/30 (76%) Frame = -1 Query: 91 LVSHGLQTACNIRACSPGDPLVLERPPPRW 2 L+S ++ N +CSPGDPLVLERPPPRW Sbjct: 8 LISANIKAGSN--SCSPGDPLVLERPPPRW 35 >SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) Length = 128 Score = 45.6 bits (103), Expect = 3e-05 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -1 Query: 70 TACNIRACSPGDPLVLERPPPRW 2 T+ + +CSPGDPLVLERPPPRW Sbjct: 2 TSLSSNSCSPGDPLVLERPPPRW 24 >SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 45.6 bits (103), Expect = 3e-05 Identities = 17/30 (56%), Positives = 22/30 (73%) Frame = -1 Query: 91 LVSHGLQTACNIRACSPGDPLVLERPPPRW 2 ++ + L + +CSPGDPLVLERPPPRW Sbjct: 10 IICNSLSYSFRSNSCSPGDPLVLERPPPRW 39 >SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 45.6 bits (103), Expect = 3e-05 Identities = 20/30 (66%), Positives = 22/30 (73%), Gaps = 3/30 (10%) Frame = -1 Query: 82 HGLQTACNIR---ACSPGDPLVLERPPPRW 2 H T C+ R +CSPGDPLVLERPPPRW Sbjct: 22 HEHVTICSYRISNSCSPGDPLVLERPPPRW 51 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 45.6 bits (103), Expect = 3e-05 Identities = 18/26 (69%), Positives = 20/26 (76%) Frame = -1 Query: 79 GLQTACNIRACSPGDPLVLERPPPRW 2 G +A +CSPGDPLVLERPPPRW Sbjct: 2416 GSSSAIASNSCSPGDPLVLERPPPRW 2441 >SB_42404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 45.6 bits (103), Expect = 3e-05 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = -1 Query: 76 LQTACNIRACSPGDPLVLERPPPRW 2 L T +CSPGDPLVLERPPPRW Sbjct: 37 LDTTQGSNSCSPGDPLVLERPPPRW 61 >SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 45.6 bits (103), Expect = 3e-05 Identities = 20/29 (68%), Positives = 23/29 (79%), Gaps = 1/29 (3%) Frame = -1 Query: 85 SHGLQTACNI-RACSPGDPLVLERPPPRW 2 S LQ + N+ +CSPGDPLVLERPPPRW Sbjct: 32 SSPLQPSENVSNSCSPGDPLVLERPPPRW 60 >SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 45.6 bits (103), Expect = 3e-05 Identities = 20/34 (58%), Positives = 22/34 (64%) Frame = -1 Query: 103 PCPFLVSHGLQTACNIRACSPGDPLVLERPPPRW 2 PC +LV +CSPGDPLVLERPPPRW Sbjct: 36 PCSYLVD-----PARSNSCSPGDPLVLERPPPRW 64 >SB_27248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 45.6 bits (103), Expect = 3e-05 Identities = 19/32 (59%), Positives = 20/32 (62%) Frame = -1 Query: 97 PFLVSHGLQTACNIRACSPGDPLVLERPPPRW 2 P L L +CSPGDPLVLERPPPRW Sbjct: 15 PILPPLSLSRYAGSNSCSPGDPLVLERPPPRW 46 >SB_16924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 45.6 bits (103), Expect = 3e-05 Identities = 19/30 (63%), Positives = 23/30 (76%) Frame = -1 Query: 91 LVSHGLQTACNIRACSPGDPLVLERPPPRW 2 L+S ++ N +CSPGDPLVLERPPPRW Sbjct: 8 LISANIRNTSN--SCSPGDPLVLERPPPRW 35 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 45.2 bits (102), Expect = 4e-05 Identities = 20/25 (80%), Positives = 21/25 (84%) Frame = -1 Query: 76 LQTACNIRACSPGDPLVLERPPPRW 2 L TA N +CSPGDPLVLERPPPRW Sbjct: 27 LLTASN--SCSPGDPLVLERPPPRW 49 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 45.2 bits (102), Expect = 4e-05 Identities = 18/30 (60%), Positives = 22/30 (73%) Frame = -1 Query: 91 LVSHGLQTACNIRACSPGDPLVLERPPPRW 2 L+S + + +CSPGDPLVLERPPPRW Sbjct: 8 LISANIVSHNTSNSCSPGDPLVLERPPPRW 37 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 45.2 bits (102), Expect = 4e-05 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = -1 Query: 82 HGLQTACNIRACSPGDPLVLERPPPRW 2 H +T N +CSPGDPLVLERPPPRW Sbjct: 12 HNPRTTSN--SCSPGDPLVLERPPPRW 36 >SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 45.2 bits (102), Expect = 4e-05 Identities = 19/26 (73%), Positives = 21/26 (80%), Gaps = 1/26 (3%) Frame = -1 Query: 76 LQTACN-IRACSPGDPLVLERPPPRW 2 L+ A N +CSPGDPLVLERPPPRW Sbjct: 54 LENAANGSNSCSPGDPLVLERPPPRW 79 >SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) Length = 428 Score = 45.2 bits (102), Expect = 4e-05 Identities = 17/26 (65%), Positives = 19/26 (73%) Frame = -1 Query: 79 GLQTACNIRACSPGDPLVLERPPPRW 2 G+ +CSPGDPLVLERPPPRW Sbjct: 154 GINCEVGSNSCSPGDPLVLERPPPRW 179 >SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 45.2 bits (102), Expect = 4e-05 Identities = 19/29 (65%), Positives = 22/29 (75%) Frame = -1 Query: 88 VSHGLQTACNIRACSPGDPLVLERPPPRW 2 + H L+ N +CSPGDPLVLERPPPRW Sbjct: 71 IDHELRFLSN--SCSPGDPLVLERPPPRW 97 >SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 45.2 bits (102), Expect = 4e-05 Identities = 18/22 (81%), Positives = 20/22 (90%), Gaps = 1/22 (4%) Frame = -1 Query: 64 CNI-RACSPGDPLVLERPPPRW 2 C+I +CSPGDPLVLERPPPRW Sbjct: 2 CDISNSCSPGDPLVLERPPPRW 23 >SB_52165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 45.2 bits (102), Expect = 4e-05 Identities = 19/26 (73%), Positives = 21/26 (80%) Frame = -1 Query: 79 GLQTACNIRACSPGDPLVLERPPPRW 2 GL + N +CSPGDPLVLERPPPRW Sbjct: 16 GLHSGSN--SCSPGDPLVLERPPPRW 39 >SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 446 Score = 45.2 bits (102), Expect = 4e-05 Identities = 21/31 (67%), Positives = 23/31 (74%), Gaps = 2/31 (6%) Frame = -1 Query: 88 VSHGLQTACNIRA--CSPGDPLVLERPPPRW 2 VS G A +R+ CSPGDPLVLERPPPRW Sbjct: 311 VSGGSYGANRVRSNSCSPGDPLVLERPPPRW 341 >SB_32855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 45.2 bits (102), Expect = 4e-05 Identities = 20/30 (66%), Positives = 23/30 (76%) Frame = -1 Query: 91 LVSHGLQTACNIRACSPGDPLVLERPPPRW 2 L+S + A N +CSPGDPLVLERPPPRW Sbjct: 8 LISANILHASN--SCSPGDPLVLERPPPRW 35 >SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 45.2 bits (102), Expect = 4e-05 Identities = 18/22 (81%), Positives = 20/22 (90%), Gaps = 1/22 (4%) Frame = -1 Query: 64 CNI-RACSPGDPLVLERPPPRW 2 C+I +CSPGDPLVLERPPPRW Sbjct: 12 CDISNSCSPGDPLVLERPPPRW 33 >SB_23309| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 45.2 bits (102), Expect = 4e-05 Identities = 20/32 (62%), Positives = 22/32 (68%), Gaps = 3/32 (9%) Frame = -1 Query: 88 VSHGLQTACNIR---ACSPGDPLVLERPPPRW 2 V H L N+ +CSPGDPLVLERPPPRW Sbjct: 13 VQHELGNMWNVEGSNSCSPGDPLVLERPPPRW 44 >SB_22515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 45.2 bits (102), Expect = 4e-05 Identities = 19/24 (79%), Positives = 21/24 (87%), Gaps = 2/24 (8%) Frame = -1 Query: 67 ACNIRA--CSPGDPLVLERPPPRW 2 + NIR+ CSPGDPLVLERPPPRW Sbjct: 10 SANIRSNSCSPGDPLVLERPPPRW 33 >SB_9177| Best HMM Match : PPI_Ypi1 (HMM E-Value=1.9) Length = 121 Score = 45.2 bits (102), Expect = 4e-05 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = -1 Query: 70 TACNIRACSPGDPLVLERPPPRW 2 T + +CSPGDPLVLERPPPRW Sbjct: 92 TGISSNSCSPGDPLVLERPPPRW 114 >SB_2728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 45.2 bits (102), Expect = 4e-05 Identities = 21/32 (65%), Positives = 23/32 (71%) Frame = -1 Query: 97 PFLVSHGLQTACNIRACSPGDPLVLERPPPRW 2 P L+ LQ N +CSPGDPLVLERPPPRW Sbjct: 19 PVLLKLVLQGLSN--SCSPGDPLVLERPPPRW 48 >SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) Length = 270 Score = 45.2 bits (102), Expect = 4e-05 Identities = 21/33 (63%), Positives = 23/33 (69%) Frame = -1 Query: 100 CPFLVSHGLQTACNIRACSPGDPLVLERPPPRW 2 C L S L T+ +CSPGDPLVLERPPPRW Sbjct: 136 CNLLFSINLITS---NSCSPGDPLVLERPPPRW 165 >SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) Length = 221 Score = 45.2 bits (102), Expect = 4e-05 Identities = 19/33 (57%), Positives = 23/33 (69%), Gaps = 1/33 (3%) Frame = -1 Query: 97 PFLVSH-GLQTACNIRACSPGDPLVLERPPPRW 2 P + H ++ A +CSPGDPLVLERPPPRW Sbjct: 84 PSIYGHEDIKRALASNSCSPGDPLVLERPPPRW 116 >SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 236 Score = 44.8 bits (101), Expect = 6e-05 Identities = 17/25 (68%), Positives = 20/25 (80%) Frame = -1 Query: 76 LQTACNIRACSPGDPLVLERPPPRW 2 L+ + +CSPGDPLVLERPPPRW Sbjct: 107 LKRSVESNSCSPGDPLVLERPPPRW 131 >SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 44.8 bits (101), Expect = 6e-05 Identities = 19/30 (63%), Positives = 23/30 (76%), Gaps = 4/30 (13%) Frame = -1 Query: 79 GLQTACNIR----ACSPGDPLVLERPPPRW 2 GL+T ++ +CSPGDPLVLERPPPRW Sbjct: 54 GLETILEVQPLSNSCSPGDPLVLERPPPRW 83 >SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.8 bits (101), Expect = 6e-05 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = -1 Query: 70 TACNIRACSPGDPLVLERPPPRW 2 T+ +CSPGDPLVLERPPPRW Sbjct: 11 TSFTSNSCSPGDPLVLERPPPRW 33 >SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 44.8 bits (101), Expect = 6e-05 Identities = 21/32 (65%), Positives = 22/32 (68%), Gaps = 1/32 (3%) Frame = -1 Query: 94 FLVSHGLQTACNI-RACSPGDPLVLERPPPRW 2 FL G A I +CSPGDPLVLERPPPRW Sbjct: 9 FLGGVGTPNAGGISNSCSPGDPLVLERPPPRW 40 >SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 44.8 bits (101), Expect = 6e-05 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -1 Query: 88 VSHGLQTACNIRACSPGDPLVLERPPPRW 2 V+ G +CSPGDPLVLERPPPRW Sbjct: 9 VTFGKSFRVTSNSCSPGDPLVLERPPPRW 37 >SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 44.8 bits (101), Expect = 6e-05 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = -1 Query: 76 LQTACNIRACSPGDPLVLERPPPRW 2 LQ +CSPGDPLVLERPPPRW Sbjct: 61 LQRQGRSNSCSPGDPLVLERPPPRW 85 >SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) Length = 558 Score = 44.8 bits (101), Expect = 6e-05 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = -1 Query: 73 QTACNIRACSPGDPLVLERPPPRW 2 QT N +CSPGDPLVLERPPPRW Sbjct: 477 QTTSN--SCSPGDPLVLERPPPRW 498 >SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) Length = 923 Score = 44.8 bits (101), Expect = 6e-05 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = -1 Query: 67 ACNIRACSPGDPLVLERPPPRW 2 A + +CSPGDPLVLERPPPRW Sbjct: 797 AISSNSCSPGDPLVLERPPPRW 818 >SB_53321| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 44.8 bits (101), Expect = 6e-05 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -1 Query: 67 ACNIRACSPGDPLVLERPPPRW 2 A +CSPGDPLVLERPPPRW Sbjct: 2 AATSNSCSPGDPLVLERPPPRW 23 >SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 44.8 bits (101), Expect = 6e-05 Identities = 18/28 (64%), Positives = 19/28 (67%) Frame = -1 Query: 85 SHGLQTACNIRACSPGDPLVLERPPPRW 2 S L +CSPGDPLVLERPPPRW Sbjct: 30 SRQLSITSTSNSCSPGDPLVLERPPPRW 57 >SB_47580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 44.8 bits (101), Expect = 6e-05 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = -1 Query: 67 ACNIRACSPGDPLVLERPPPRW 2 A + +CSPGDPLVLERPPPRW Sbjct: 4 ASSSNSCSPGDPLVLERPPPRW 25 >SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 44.8 bits (101), Expect = 6e-05 Identities = 18/30 (60%), Positives = 20/30 (66%) Frame = -1 Query: 91 LVSHGLQTACNIRACSPGDPLVLERPPPRW 2 L+ A +CSPGDPLVLERPPPRW Sbjct: 16 LIKTANSKATRSNSCSPGDPLVLERPPPRW 45 >SB_36834| Best HMM Match : Rap_GAP (HMM E-Value=0.00045) Length = 545 Score = 44.8 bits (101), Expect = 6e-05 Identities = 19/24 (79%), Positives = 20/24 (83%), Gaps = 1/24 (4%) Frame = -1 Query: 70 TACNI-RACSPGDPLVLERPPPRW 2 TA N +CSPGDPLVLERPPPRW Sbjct: 248 TAINASNSCSPGDPLVLERPPPRW 271 >SB_36586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 44.8 bits (101), Expect = 6e-05 Identities = 19/31 (61%), Positives = 23/31 (74%) Frame = -1 Query: 94 FLVSHGLQTACNIRACSPGDPLVLERPPPRW 2 F G++T+ +CSPGDPLVLERPPPRW Sbjct: 3 FWFGSGIRTS---NSCSPGDPLVLERPPPRW 30 >SB_34241| Best HMM Match : RuvA_C (HMM E-Value=1.5) Length = 274 Score = 44.8 bits (101), Expect = 6e-05 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -1 Query: 73 QTACNIRACSPGDPLVLERPPPRW 2 + A + +CSPGDPLVLERPPPRW Sbjct: 146 EVANSSNSCSPGDPLVLERPPPRW 169 >SB_32720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 209 Score = 44.8 bits (101), Expect = 6e-05 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -1 Query: 88 VSHGLQTACNIRACSPGDPLVLERPPPRW 2 + GL +CSPGDPLVLERPPPRW Sbjct: 76 IHSGLNEHSLSNSCSPGDPLVLERPPPRW 104 >SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 44.8 bits (101), Expect = 6e-05 Identities = 19/32 (59%), Positives = 22/32 (68%) Frame = -1 Query: 97 PFLVSHGLQTACNIRACSPGDPLVLERPPPRW 2 P + H + N +CSPGDPLVLERPPPRW Sbjct: 27 PDPMQHAIPALSN--SCSPGDPLVLERPPPRW 56 >SB_25872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/35 (57%), Positives = 22/35 (62%) Frame = -1 Query: 106 FPCPFLVSHGLQTACNIRACSPGDPLVLERPPPRW 2 F C L + L +CSPGDPLVLERPPPRW Sbjct: 7 FTCA-LQQNRLDLTFTSNSCSPGDPLVLERPPPRW 40 >SB_21311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 44.8 bits (101), Expect = 6e-05 Identities = 19/31 (61%), Positives = 23/31 (74%) Frame = -1 Query: 94 FLVSHGLQTACNIRACSPGDPLVLERPPPRW 2 + + H + A N +CSPGDPLVLERPPPRW Sbjct: 10 YTLDHTERRASN--SCSPGDPLVLERPPPRW 38 >SB_17014| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/28 (71%), Positives = 22/28 (78%) Frame = -1 Query: 85 SHGLQTACNIRACSPGDPLVLERPPPRW 2 S LQT+ +CSPGDPLVLERPPPRW Sbjct: 10 SRRLQTS---NSCSPGDPLVLERPPPRW 34 >SB_6342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 44.8 bits (101), Expect = 6e-05 Identities = 18/30 (60%), Positives = 24/30 (80%), Gaps = 3/30 (10%) Frame = -1 Query: 82 HGLQTACNIRA---CSPGDPLVLERPPPRW 2 H +++ C+ ++ CSPGDPLVLERPPPRW Sbjct: 19 HIIKSRCSCQSSNSCSPGDPLVLERPPPRW 48 >SB_5539| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.033) Length = 551 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/34 (58%), Positives = 24/34 (70%), Gaps = 4/34 (11%) Frame = -1 Query: 91 LVSHGLQT----ACNIRACSPGDPLVLERPPPRW 2 LVS+G+ + +CSPGDPLVLERPPPRW Sbjct: 413 LVSYGINAYWYRMVSSNSCSPGDPLVLERPPPRW 446 >SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 44.8 bits (101), Expect = 6e-05 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = -1 Query: 70 TACNIRACSPGDPLVLERPPPRW 2 T +CSPGDPLVLERPPPRW Sbjct: 2 TGLRSNSCSPGDPLVLERPPPRW 24 >SB_3601| Best HMM Match : DUF765 (HMM E-Value=3.9) Length = 146 Score = 44.8 bits (101), Expect = 6e-05 Identities = 17/26 (65%), Positives = 18/26 (69%) Frame = -1 Query: 79 GLQTACNIRACSPGDPLVLERPPPRW 2 G +CSPGDPLVLERPPPRW Sbjct: 16 GAHNMAGSNSCSPGDPLVLERPPPRW 41 >SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1295 Score = 44.8 bits (101), Expect = 6e-05 Identities = 24/61 (39%), Positives = 28/61 (45%), Gaps = 1/61 (1%) Frame = -1 Query: 181 CRSSDQWWWTXXXXXXXXXXXXCESFPCPFLVSHGLQTACNI-RACSPGDPLVLERPPPR 5 CR W+ E + P +V G I +CSPGDPLVLERPPPR Sbjct: 551 CRDRGMGWYPRVVIEGWYPRVVIEGW-YPRVVIEGWYPRVGISNSCSPGDPLVLERPPPR 609 Query: 4 W 2 W Sbjct: 610 W 610 >SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 44.8 bits (101), Expect = 6e-05 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = -1 Query: 73 QTACNIRACSPGDPLVLERPPPRW 2 Q + +CSPGDPLVLERPPPRW Sbjct: 31 QESIRSNSCSPGDPLVLERPPPRW 54 >SB_1971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 44.8 bits (101), Expect = 6e-05 Identities = 18/31 (58%), Positives = 24/31 (77%) Frame = -1 Query: 94 FLVSHGLQTACNIRACSPGDPLVLERPPPRW 2 +L++ G+ + +CSPGDPLVLERPPPRW Sbjct: 5 YLITRGVSS----NSCSPGDPLVLERPPPRW 31 >SB_1736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 44.8 bits (101), Expect = 6e-05 Identities = 19/30 (63%), Positives = 22/30 (73%) Frame = -1 Query: 91 LVSHGLQTACNIRACSPGDPLVLERPPPRW 2 L+S + N +CSPGDPLVLERPPPRW Sbjct: 8 LISANISQTSN--SCSPGDPLVLERPPPRW 35 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 44.4 bits (100), Expect = 8e-05 Identities = 17/25 (68%), Positives = 20/25 (80%) Frame = -1 Query: 76 LQTACNIRACSPGDPLVLERPPPRW 2 ++T +CSPGDPLVLERPPPRW Sbjct: 6 MKTREKSNSCSPGDPLVLERPPPRW 30 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/26 (69%), Positives = 19/26 (73%) Frame = -1 Query: 79 GLQTACNIRACSPGDPLVLERPPPRW 2 G T +CSPGDPLVLERPPPRW Sbjct: 177 GTTTIPPSNSCSPGDPLVLERPPPRW 202 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 44.4 bits (100), Expect = 8e-05 Identities = 21/33 (63%), Positives = 26/33 (78%), Gaps = 3/33 (9%) Frame = -1 Query: 91 LVSHGLQTACNIR---ACSPGDPLVLERPPPRW 2 L+SH QT +++ +CSPGDPLVLERPPPRW Sbjct: 89 LISHR-QTNKSLKISNSCSPGDPLVLERPPPRW 120 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 44.4 bits (100), Expect = 8e-05 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -1 Query: 67 ACNIRACSPGDPLVLERPPPRW 2 A +CSPGDPLVLERPPPRW Sbjct: 11 AVRSNSCSPGDPLVLERPPPRW 32 >SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 44.4 bits (100), Expect = 8e-05 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = -1 Query: 70 TACNIRACSPGDPLVLERPPPRW 2 TA N +CSPGDPLVLERPPPRW Sbjct: 13 TASN--SCSPGDPLVLERPPPRW 33 >SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) Length = 327 Score = 44.4 bits (100), Expect = 8e-05 Identities = 17/25 (68%), Positives = 20/25 (80%) Frame = -1 Query: 76 LQTACNIRACSPGDPLVLERPPPRW 2 L + + +CSPGDPLVLERPPPRW Sbjct: 198 LMYSSSSNSCSPGDPLVLERPPPRW 222 >SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1887 Score = 44.4 bits (100), Expect = 8e-05 Identities = 17/28 (60%), Positives = 19/28 (67%) Frame = -1 Query: 85 SHGLQTACNIRACSPGDPLVLERPPPRW 2 +H +CSPGDPLVLERPPPRW Sbjct: 1013 AHVFVVGLGSNSCSPGDPLVLERPPPRW 1040 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 44.4 bits (100), Expect = 8e-05 Identities = 20/33 (60%), Positives = 21/33 (63%) Frame = -1 Query: 100 CPFLVSHGLQTACNIRACSPGDPLVLERPPPRW 2 C LV Q +CSPGDPLVLERPPPRW Sbjct: 107 CRQLVRAKNQKEIISNSCSPGDPLVLERPPPRW 139 >SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/26 (69%), Positives = 22/26 (84%) Frame = -1 Query: 79 GLQTACNIRACSPGDPLVLERPPPRW 2 G++T + +CSPGDPLVLERPPPRW Sbjct: 11 GVRTPTS-NSCSPGDPLVLERPPPRW 35 >SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 44.4 bits (100), Expect = 8e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -1 Query: 88 VSHGLQTACNIRACSPGDPLVLERPPPRW 2 + H T N +CSPGDPLVLERPPPRW Sbjct: 1 MKHFTDTLSN--SCSPGDPLVLERPPPRW 27 >SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 44.4 bits (100), Expect = 8e-05 Identities = 19/30 (63%), Positives = 23/30 (76%) Frame = -1 Query: 91 LVSHGLQTACNIRACSPGDPLVLERPPPRW 2 L+S ++ N +CSPGDPLVLERPPPRW Sbjct: 8 LISANIKFRSN--SCSPGDPLVLERPPPRW 35 >SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = -1 Query: 76 LQTACNIRACSPGDPLVLERPPPRW 2 LQ +CSPGDPLVLERPPPRW Sbjct: 64 LQPHPRSNSCSPGDPLVLERPPPRW 88 >SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 44.4 bits (100), Expect = 8e-05 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = -1 Query: 70 TACNIRACSPGDPLVLERPPPRW 2 TA N +CSPGDPLVLERPPPRW Sbjct: 24 TASN--SCSPGDPLVLERPPPRW 44 >SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 44.4 bits (100), Expect = 8e-05 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = -1 Query: 70 TACNIRACSPGDPLVLERPPPRW 2 T+ +CSPGDPLVLERPPPRW Sbjct: 2 TSNRSNSCSPGDPLVLERPPPRW 24 >SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 44.4 bits (100), Expect = 8e-05 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = -1 Query: 70 TACNIRACSPGDPLVLERPPPRW 2 TA N +CSPGDPLVLERPPPRW Sbjct: 5 TASN--SCSPGDPLVLERPPPRW 25 >SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 44.4 bits (100), Expect = 8e-05 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = -1 Query: 70 TACNIRACSPGDPLVLERPPPRW 2 T +CSPGDPLVLERPPPRW Sbjct: 16 TILGSNSCSPGDPLVLERPPPRW 38 >SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 44.4 bits (100), Expect = 8e-05 Identities = 21/33 (63%), Positives = 22/33 (66%) Frame = -1 Query: 100 CPFLVSHGLQTACNIRACSPGDPLVLERPPPRW 2 C VS Q N +CSPGDPLVLERPPPRW Sbjct: 2 CGSRVSIKQQATSN--SCSPGDPLVLERPPPRW 32 >SB_43468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 44.4 bits (100), Expect = 8e-05 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = -1 Query: 70 TACNIRACSPGDPLVLERPPPRW 2 TA N +CSPGDPLVLERPPPRW Sbjct: 18 TASN--SCSPGDPLVLERPPPRW 38 >SB_42272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 44.4 bits (100), Expect = 8e-05 Identities = 19/31 (61%), Positives = 23/31 (74%), Gaps = 2/31 (6%) Frame = -1 Query: 88 VSHGLQTACNIRA--CSPGDPLVLERPPPRW 2 + H +Q I++ CSPGDPLVLERPPPRW Sbjct: 2 IVHKIQKFYRIQSNSCSPGDPLVLERPPPRW 32 >SB_33340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 44.4 bits (100), Expect = 8e-05 Identities = 17/22 (77%), Positives = 20/22 (90%), Gaps = 1/22 (4%) Frame = -1 Query: 64 CNI-RACSPGDPLVLERPPPRW 2 C++ +CSPGDPLVLERPPPRW Sbjct: 6 CSLSNSCSPGDPLVLERPPPRW 27 >SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/26 (69%), Positives = 19/26 (73%) Frame = -1 Query: 79 GLQTACNIRACSPGDPLVLERPPPRW 2 G T +CSPGDPLVLERPPPRW Sbjct: 54 GTVTHRRSNSCSPGDPLVLERPPPRW 79 >SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 44.4 bits (100), Expect = 8e-05 Identities = 20/31 (64%), Positives = 21/31 (67%) Frame = -1 Query: 94 FLVSHGLQTACNIRACSPGDPLVLERPPPRW 2 F V G N +CSPGDPLVLERPPPRW Sbjct: 23 FRVKEGKIAVSN--SCSPGDPLVLERPPPRW 51 >SB_22418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 44.4 bits (100), Expect = 8e-05 Identities = 20/33 (60%), Positives = 23/33 (69%), Gaps = 3/33 (9%) Frame = -1 Query: 91 LVSHGLQTACNIRA---CSPGDPLVLERPPPRW 2 L+S + T + A CSPGDPLVLERPPPRW Sbjct: 8 LISANINTQSKLVASNSCSPGDPLVLERPPPRW 40 >SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 44.4 bits (100), Expect = 8e-05 Identities = 17/22 (77%), Positives = 19/22 (86%), Gaps = 1/22 (4%) Frame = -1 Query: 64 CNI-RACSPGDPLVLERPPPRW 2 C + +CSPGDPLVLERPPPRW Sbjct: 32 CTVSNSCSPGDPLVLERPPPRW 53 >SB_18474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 44.4 bits (100), Expect = 8e-05 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = -1 Query: 70 TACNIRACSPGDPLVLERPPPRW 2 T +CSPGDPLVLERPPPRW Sbjct: 9 TLTRSNSCSPGDPLVLERPPPRW 31 >SB_17505| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -1 Query: 88 VSHGLQTACNIRACSPGDPLVLERPPPRW 2 +SH +CSPGDPLVLERPPPRW Sbjct: 11 LSHITDLYWESNSCSPGDPLVLERPPPRW 39 >SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) Length = 802 Score = 44.4 bits (100), Expect = 8e-05 Identities = 19/34 (55%), Positives = 20/34 (58%) Frame = -1 Query: 103 PCPFLVSHGLQTACNIRACSPGDPLVLERPPPRW 2 P P L +CSPGDPLVLERPPPRW Sbjct: 76 PSPILYCSAECVMTISNSCSPGDPLVLERPPPRW 109 >SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/26 (69%), Positives = 19/26 (73%) Frame = -1 Query: 79 GLQTACNIRACSPGDPLVLERPPPRW 2 G T +CSPGDPLVLERPPPRW Sbjct: 99 GWSTFILSNSCSPGDPLVLERPPPRW 124 >SB_16113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 44.4 bits (100), Expect = 8e-05 Identities = 19/26 (73%), Positives = 21/26 (80%) Frame = -1 Query: 79 GLQTACNIRACSPGDPLVLERPPPRW 2 G+ A N +CSPGDPLVLERPPPRW Sbjct: 17 GICAASN--SCSPGDPLVLERPPPRW 40 >SB_16044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 44.4 bits (100), Expect = 8e-05 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = -1 Query: 70 TACNIRACSPGDPLVLERPPPRW 2 T + +CSPGDPLVLERPPPRW Sbjct: 14 TNISSNSCSPGDPLVLERPPPRW 36 >SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 44.4 bits (100), Expect = 8e-05 Identities = 19/27 (70%), Positives = 20/27 (74%) Frame = -1 Query: 82 HGLQTACNIRACSPGDPLVLERPPPRW 2 HG N +CSPGDPLVLERPPPRW Sbjct: 58 HGSNFLSN--SCSPGDPLVLERPPPRW 82 >SB_15081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 44.4 bits (100), Expect = 8e-05 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = -1 Query: 70 TACNIRACSPGDPLVLERPPPRW 2 TA N +CSPGDPLVLERPPPRW Sbjct: 14 TASN--SCSPGDPLVLERPPPRW 34 >SB_14354| Best HMM Match : TEP1_N (HMM E-Value=4.1) Length = 275 Score = 44.4 bits (100), Expect = 8e-05 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -1 Query: 82 HGLQTACNIRACSPGDPLVLERPPPRW 2 H +CSPGDPLVLERPPPRW Sbjct: 144 HSAAVGGGSNSCSPGDPLVLERPPPRW 170 >SB_14019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 44.4 bits (100), Expect = 8e-05 Identities = 19/30 (63%), Positives = 22/30 (73%) Frame = -1 Query: 91 LVSHGLQTACNIRACSPGDPLVLERPPPRW 2 L+S + N +CSPGDPLVLERPPPRW Sbjct: 8 LISANILAGSN--SCSPGDPLVLERPPPRW 35 >SB_7770| Best HMM Match : Aldolase_II (HMM E-Value=2.6e-12) Length = 716 Score = 44.4 bits (100), Expect = 8e-05 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 76 LQTACNIRACSPGDPLVLERPPPRW 2 L+ +CSPGDPLVLERPPPRW Sbjct: 262 LEEIVGSNSCSPGDPLVLERPPPRW 286 >SB_5594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 44.4 bits (100), Expect = 8e-05 Identities = 17/26 (65%), Positives = 20/26 (76%) Frame = -1 Query: 79 GLQTACNIRACSPGDPLVLERPPPRW 2 G + + +CSPGDPLVLERPPPRW Sbjct: 5 GREKSGGSNSCSPGDPLVLERPPPRW 30 >SB_261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 44.4 bits (100), Expect = 8e-05 Identities = 19/32 (59%), Positives = 23/32 (71%), Gaps = 2/32 (6%) Frame = -1 Query: 91 LVSHGLQTACN--IRACSPGDPLVLERPPPRW 2 L+S ++ N +CSPGDPLVLERPPPRW Sbjct: 8 LISANIKALTNKSSNSCSPGDPLVLERPPPRW 39 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 37 SCSPGDPLVLERPPPRW 53 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 28 SCSPGDPLVLERPPPRW 44 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 5 SCSPGDPLVLERPPPRW 21 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 20 SCSPGDPLVLERPPPRW 36 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 29 SCSPGDPLVLERPPPRW 45 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 81 SCSPGDPLVLERPPPRW 97 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 17 SCSPGDPLVLERPPPRW 33 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 351 SCSPGDPLVLERPPPRW 367 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 9 SCSPGDPLVLERPPPRW 25 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 8 SCSPGDPLVLERPPPRW 24 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 20 SCSPGDPLVLERPPPRW 36 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 29 SCSPGDPLVLERPPPRW 45 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 13 SCSPGDPLVLERPPPRW 29 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 33 SCSPGDPLVLERPPPRW 49 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 9 SCSPGDPLVLERPPPRW 25 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 37 SCSPGDPLVLERPPPRW 53 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 6 SCSPGDPLVLERPPPRW 22 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 84 SCSPGDPLVLERPPPRW 100 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 4 SCSPGDPLVLERPPPRW 20 >SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2070 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 518 SCSPGDPLVLERPPPRW 534 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 384 SCSPGDPLVLERPPPRW 400 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 26 SCSPGDPLVLERPPPRW 42 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 16 SCSPGDPLVLERPPPRW 32 >SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 24 SCSPGDPLVLERPPPRW 40 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 4 SCSPGDPLVLERPPPRW 20 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 10 SCSPGDPLVLERPPPRW 26 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 24 SCSPGDPLVLERPPPRW 40 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 5 SCSPGDPLVLERPPPRW 21 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 19 SCSPGDPLVLERPPPRW 35 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 264 SCSPGDPLVLERPPPRW 280 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 27 SCSPGDPLVLERPPPRW 43 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 21 SCSPGDPLVLERPPPRW 37 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 13 SCSPGDPLVLERPPPRW 29 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 13 SCSPGDPLVLERPPPRW 29 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 13 SCSPGDPLVLERPPPRW 29 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 21 SCSPGDPLVLERPPPRW 37 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 15 SCSPGDPLVLERPPPRW 31 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 165 SCSPGDPLVLERPPPRW 181 >SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) Length = 143 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 22 SCSPGDPLVLERPPPRW 38 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 23 SCSPGDPLVLERPPPRW 39 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 19 SCSPGDPLVLERPPPRW 35 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 37 SCSPGDPLVLERPPPRW 53 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 66 SCSPGDPLVLERPPPRW 82 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 19 SCSPGDPLVLERPPPRW 35 >SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 754 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/33 (54%), Positives = 21/33 (63%) Frame = -1 Query: 100 CPFLVSHGLQTACNIRACSPGDPLVLERPPPRW 2 C G + + +A SPGDPLVLERPPPRW Sbjct: 617 CAVATQGGTLSEYDTKATSPGDPLVLERPPPRW 649 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 18 SCSPGDPLVLERPPPRW 34 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 7 SCSPGDPLVLERPPPRW 23 >SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 6 SCSPGDPLVLERPPPRW 22 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 13 SCSPGDPLVLERPPPRW 29 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 50 SCSPGDPLVLERPPPRW 66 >SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 15 SCSPGDPLVLERPPPRW 31 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 895 SCSPGDPLVLERPPPRW 911 >SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 27 SCSPGDPLVLERPPPRW 43 >SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 16 SCSPGDPLVLERPPPRW 32 >SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) Length = 166 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 45 SCSPGDPLVLERPPPRW 61 >SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 96 SCSPGDPLVLERPPPRW 112 >SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) Length = 999 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 878 SCSPGDPLVLERPPPRW 894 >SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) Length = 130 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 9 SCSPGDPLVLERPPPRW 25 >SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 13 SCSPGDPLVLERPPPRW 29 >SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 65 SCSPGDPLVLERPPPRW 81 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 7 SCSPGDPLVLERPPPRW 23 >SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 20 SCSPGDPLVLERPPPRW 36 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 66 SCSPGDPLVLERPPPRW 82 >SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 45 SCSPGDPLVLERPPPRW 61 >SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 28 SCSPGDPLVLERPPPRW 44 >SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 41 SCSPGDPLVLERPPPRW 57 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 17 SCSPGDPLVLERPPPRW 33 >SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 43 SCSPGDPLVLERPPPRW 59 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 5 SCSPGDPLVLERPPPRW 21 >SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 42 SCSPGDPLVLERPPPRW 58 >SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) Length = 265 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 144 SCSPGDPLVLERPPPRW 160 >SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 4 SCSPGDPLVLERPPPRW 20 >SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 37 SCSPGDPLVLERPPPRW 53 >SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 83 SCSPGDPLVLERPPPRW 99 >SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 38 SCSPGDPLVLERPPPRW 54 >SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 26 SCSPGDPLVLERPPPRW 42 >SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 6 SCSPGDPLVLERPPPRW 22 >SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 6 SCSPGDPLVLERPPPRW 22 >SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 56 SCSPGDPLVLERPPPRW 72 >SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 9 SCSPGDPLVLERPPPRW 25 >SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 4 SCSPGDPLVLERPPPRW 20 >SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 25 SCSPGDPLVLERPPPRW 41 >SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 36 SCSPGDPLVLERPPPRW 52 >SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 4 SCSPGDPLVLERPPPRW 20 >SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 49 SCSPGDPLVLERPPPRW 65 >SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 16 SCSPGDPLVLERPPPRW 32 >SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 4 SCSPGDPLVLERPPPRW 20 >SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 5 SCSPGDPLVLERPPPRW 21 >SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 6 SCSPGDPLVLERPPPRW 22 >SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 14 SCSPGDPLVLERPPPRW 30 >SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 10 SCSPGDPLVLERPPPRW 26 >SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) Length = 186 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 65 SCSPGDPLVLERPPPRW 81 >SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 25 SCSPGDPLVLERPPPRW 41 >SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 7 SCSPGDPLVLERPPPRW 23 >SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 45 SCSPGDPLVLERPPPRW 61 >SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 32 SCSPGDPLVLERPPPRW 48 >SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 41 SCSPGDPLVLERPPPRW 57 >SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 24 SCSPGDPLVLERPPPRW 40 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 41 SCSPGDPLVLERPPPRW 57 >SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 18 SCSPGDPLVLERPPPRW 34 >SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 19 SCSPGDPLVLERPPPRW 35 >SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 62 SCSPGDPLVLERPPPRW 78 >SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 8 SCSPGDPLVLERPPPRW 24 >SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1010 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 86 SCSPGDPLVLERPPPRW 102 >SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 15 SCSPGDPLVLERPPPRW 31 >SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 7 SCSPGDPLVLERPPPRW 23 >SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 6 SCSPGDPLVLERPPPRW 22 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 21 SCSPGDPLVLERPPPRW 37 >SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 12 SCSPGDPLVLERPPPRW 28 >SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) Length = 174 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 53 SCSPGDPLVLERPPPRW 69 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 43 SCSPGDPLVLERPPPRW 59 >SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 13 SCSPGDPLVLERPPPRW 29 >SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 11 SCSPGDPLVLERPPPRW 27 >SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 120 SCSPGDPLVLERPPPRW 136 >SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) Length = 365 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 244 SCSPGDPLVLERPPPRW 260 >SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 15 SCSPGDPLVLERPPPRW 31 >SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 187 SCSPGDPLVLERPPPRW 203 >SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 6 SCSPGDPLVLERPPPRW 22 >SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 10 SCSPGDPLVLERPPPRW 26 >SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 137 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 ACSPGDPLVLERPPPRW 2 +CSPGDPLVLERPPPRW Sbjct: 17 SCSPGDPLVLERPPPRW 33 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,763,373 Number of Sequences: 59808 Number of extensions: 398217 Number of successful extensions: 2611 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 2524 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2610 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1572561250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -