BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060811.seq (471 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory recept... 24 0.62 AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory recept... 24 0.62 AF265298-1|AAG17641.1| 124|Tribolium castaneum putative cytochr... 24 0.81 AF265213-1|AAF75277.1| 143|Tribolium castaneum putative cytochr... 21 4.3 >AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory receptor candidate 13 protein. Length = 390 Score = 24.2 bits (50), Expect = 0.62 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -3 Query: 409 VSSLLTTFESDCHRMKCRTVDGF 341 V +L T E +C++MK T+D F Sbjct: 253 VKTLTTVVEKECYKMKV-TIDAF 274 >AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory receptor candidate 12 protein. Length = 316 Score = 24.2 bits (50), Expect = 0.62 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -3 Query: 409 VSSLLTTFESDCHRMKCRTVDGF 341 V +L T E +C++MK T+D F Sbjct: 179 VKTLTTVVEKECYKMKV-TIDAF 200 >AF265298-1|AAG17641.1| 124|Tribolium castaneum putative cytochrome P450 monooxigenase protein. Length = 124 Score = 23.8 bits (49), Expect = 0.81 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = -1 Query: 315 LETGARFISHASPFATSVSSFLLRLHHRQDHRPDP 211 LE + P T +S F+ +HH + + P+P Sbjct: 68 LEVDCNIGGYDFPKDTFLSLFIYGMHHNEKYFPEP 102 >AF265213-1|AAF75277.1| 143|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q3 protein. Length = 143 Score = 21.4 bits (43), Expect = 4.3 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = -1 Query: 279 PFATSVSSFLLRLHHRQDHRPDP 211 P +T + LHH D PDP Sbjct: 99 PKSTITHLHIYDLHHNPDIYPDP 121 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 85,340 Number of Sequences: 336 Number of extensions: 1407 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10931752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -