BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060810.seq (630 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY748834-1|AAV28182.1| 171|Anopheles gambiae cytochrome P450 pr... 25 2.0 AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CY... 25 2.6 AY028782-1|AAK32956.1| 501|Anopheles gambiae cytochrome P450 pr... 24 3.5 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 24 3.5 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 24 3.5 U43499-1|AAA93302.1| 278|Anopheles gambiae a-emp protein. 24 4.6 AY805323-1|AAV66543.1| 459|Anopheles gambiae beta subunit-GABA-... 24 4.6 AY313948-1|AAP76391.1| 424|Anopheles gambiae cytochrome P450 CY... 24 4.6 AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 24 4.6 AY062204-1|AAL58565.1| 150|Anopheles gambiae cytochrome P450 CY... 23 6.1 AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 23 6.1 AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled ... 23 8.0 AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein... 23 8.0 >AY748834-1|AAV28182.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 25.0 bits (52), Expect = 2.0 Identities = 13/40 (32%), Positives = 23/40 (57%), Gaps = 3/40 (7%) Frame = -3 Query: 271 TSVSSCLLRLHHRQDHRPDP*R---ERAFDSRPPRSFDPW 161 TSV+ + +HH D+ PD R +R +R ++F+P+ Sbjct: 77 TSVAIDIYTMHHSDDYFPDAERFDPDRFEGARDAQTFNPY 116 >AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CYP6P2 protein. Length = 507 Score = 24.6 bits (51), Expect = 2.6 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = -3 Query: 292 SHASPFATSVSSCLLRLHHRQDHRPDP*R 206 +H P T + + LHH + PDP R Sbjct: 395 AHVIPKGTMIQIPIYALHHDAQYYPDPER 423 >AY028782-1|AAK32956.1| 501|Anopheles gambiae cytochrome P450 protein. Length = 501 Score = 24.2 bits (50), Expect = 3.5 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 7/47 (14%) Frame = -3 Query: 280 PFATSVSSCLLRLHHRQDHRPDP*R-------ERAFDSRPPRSFDPW 161 P +V + +HH D+ PDP R A +SR P SF P+ Sbjct: 391 PKGMNVMIPVYAIHHDADNYPDPERYDPDRFAPEACESRKPYSFIPF 437 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 24.2 bits (50), Expect = 3.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +1 Query: 313 PSHTPASQQPNPSTV 357 PSH PA QP P+ V Sbjct: 369 PSHIPAGSQPVPAVV 383 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 24.2 bits (50), Expect = 3.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +1 Query: 313 PSHTPASQQPNPSTV 357 PSH PA QP P+ V Sbjct: 368 PSHIPAGSQPVPAVV 382 >U43499-1|AAA93302.1| 278|Anopheles gambiae a-emp protein. Length = 278 Score = 23.8 bits (49), Expect = 4.6 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +1 Query: 187 ESRTHALVKDLVGGLADDVV 246 + R + +DL GGL DDVV Sbjct: 33 QKRVYIFNEDLSGGLEDDVV 52 >AY805323-1|AAV66543.1| 459|Anopheles gambiae beta subunit-GABA-A-gated chloride channelprotein. Length = 459 Score = 23.8 bits (49), Expect = 4.6 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +2 Query: 257 RTYGGRKRTGMRYKPS 304 R+YG R+G+RY+ S Sbjct: 386 RSYGSSNRSGLRYRSS 401 >AY313948-1|AAP76391.1| 424|Anopheles gambiae cytochrome P450 CYP6M4 protein. Length = 424 Score = 23.8 bits (49), Expect = 4.6 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -3 Query: 271 TSVSSCLLRLHHRQDHRPDP*R 206 TSV +L +HH +H P+P R Sbjct: 334 TSVMIPVLGIHHDPEHFPEPER 355 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 23.8 bits (49), Expect = 4.6 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +1 Query: 313 PSHTPASQQPNPSTVLHFIRWQSLSKVVRRLLTRCSPG 426 P+H P + Q NP +V + + + R L +R PG Sbjct: 387 PTHQPTTSQENPESVTD----EEIRNIGRSLKSRKVPG 420 >AY062204-1|AAL58565.1| 150|Anopheles gambiae cytochrome P450 CYP4C28 protein. Length = 150 Score = 23.4 bits (48), Expect = 6.1 Identities = 12/39 (30%), Positives = 17/39 (43%) Frame = -3 Query: 328 LAYDLETGARFISHASPFATSVSSCLLRLHHRQDHRPDP 212 L+ L TG H P T+ L +LH + P+P Sbjct: 78 LSRTLTTGVDIEGHHIPSGTNAVIMLYQLHRDPQYFPNP 116 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 23.4 bits (48), Expect = 6.1 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = -2 Query: 536 FLSFLLGVATNIIVWFFALRTLLILXSSASGVD 438 F+S LLG+AT+I+ ALR +L + SG + Sbjct: 340 FVSELLGIATDIL--GKALRQQTVLQRTPSGTE 370 >AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled receptor protein. Length = 611 Score = 23.0 bits (47), Expect = 8.0 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -2 Query: 431 LHPGEHLVSSLLTTFESD 378 LHPG H +SS L T D Sbjct: 111 LHPGVHQLSSGLVTLVGD 128 >AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein coupled receptor protein. Length = 612 Score = 23.0 bits (47), Expect = 8.0 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -2 Query: 431 LHPGEHLVSSLLTTFESD 378 LHPG H +SS L T D Sbjct: 112 LHPGVHQLSSGLVTLVGD 129 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 557,404 Number of Sequences: 2352 Number of extensions: 9487 Number of successful extensions: 28 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 61468785 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -