BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060810.seq (630 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014134-3175|AAF53856.2| 916|Drosophila melanogaster CG10662-P... 28 9.1 >AE014134-3175|AAF53856.2| 916|Drosophila melanogaster CG10662-PA protein. Length = 916 Score = 28.3 bits (60), Expect = 9.1 Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = -1 Query: 249 CDYIIGKTTDQILDESVRSTL-DRLGRLIHGSS 154 C YI GKTT Q LD VR T D + R+ G++ Sbjct: 488 CTYISGKTTWQNLDYVVRKTFKDYVARIDPGTN 520 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,713,456 Number of Sequences: 53049 Number of extensions: 454320 Number of successful extensions: 1361 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1304 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1361 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2621070450 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -