BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060806.seq (508 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC338.08 |ctp1|mug38|sequence orphan|Schizosaccharomyces pombe... 25 8.6 SPBC1604.12 |||sequence orphan|Schizosaccharomyces pombe|chr 2||... 25 8.6 SPCC736.14 |dis1||microtubule-associated protein Dis1 |Schizosac... 25 8.6 >SPCC338.08 |ctp1|mug38|sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 285 Score = 24.6 bits (51), Expect = 8.6 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +3 Query: 6 REEIGLEKKTYDEVEYLEEDVTNNSQPEKDPITVC 110 R++ G EKK E E+L +DV ++ + P C Sbjct: 192 RQKKGTEKKRPFEPEFLNDDVIRGNKRKALPAYEC 226 >SPBC1604.12 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 860 Score = 24.6 bits (51), Expect = 8.6 Identities = 16/62 (25%), Positives = 25/62 (40%) Frame = +3 Query: 39 DEVEYLEEDVTNNSQPEKDPITVCLTRPKXLPRAKPIKKYLQYTXXDLRXGVEAVRNNRM 218 +E++ LEE V K P+ + T P + P K +Q R + A R + Sbjct: 787 EEMKPLEEKVPIYRSSSKQPLRIHPTHPLRVTVCLPGSKTIQVARRSFRNSMNANRYDPQ 846 Query: 219 SR 224 R Sbjct: 847 RR 848 >SPCC736.14 |dis1||microtubule-associated protein Dis1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 882 Score = 24.6 bits (51), Expect = 8.6 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Frame = +3 Query: 15 IGLEKKTYDEVEYLEEDVTNNSQPEKDPITVCLTRPKXLPR-AKPIK 152 +GL+ K ++ L +D+T N+ P + +RP+ LPR A P+K Sbjct: 515 VGLDPKKLPKILELSKDITVNAHPNQP------SRPR-LPRVASPLK 554 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,537,038 Number of Sequences: 5004 Number of extensions: 23187 Number of successful extensions: 45 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 44 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 45 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 202220600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -