BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060806.seq (508 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48138| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_29494| Best HMM Match : Mpp10 (HMM E-Value=0.62) 27 6.7 >SB_48138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1913 Score = 29.9 bits (64), Expect = 1.3 Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +3 Query: 57 EEDVTNNSQPEKD-PITVCLTRPKXLPRAKPIKKYL 161 E +VTN S+ + PI + +PK P+AKP K L Sbjct: 1085 EAEVTNESEETSEMPIYAAVQKPKDKPKAKPKPKEL 1120 >SB_29494| Best HMM Match : Mpp10 (HMM E-Value=0.62) Length = 631 Score = 27.5 bits (58), Expect = 6.7 Identities = 11/26 (42%), Positives = 20/26 (76%) Frame = +3 Query: 18 GLEKKTYDEVEYLEEDVTNNSQPEKD 95 G E+K +EVE++E++ N+S+ EK+ Sbjct: 245 GEEQKEEEEVEWVEKEKVNSSEIEKE 270 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,841,910 Number of Sequences: 59808 Number of extensions: 189724 Number of successful extensions: 370 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 359 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 370 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1111677931 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -