Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV060805.seq
         (651 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY316682-1|AAQ83696.1|  456|Tribolium castaneum Sp-like zinc fin...    21   8.8  
AF236856-1|AAG17563.2|  370|Tribolium castaneum Kruppel protein ...    21   8.8  

>AY316682-1|AAQ83696.1|  456|Tribolium castaneum Sp-like zinc finger
           protein protein.
          Length = 456

 Score = 21.0 bits (42), Expect = 8.8
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = -3

Query: 184 PFPFNWVFC 158
           PF  NW+FC
Sbjct: 344 PFVCNWLFC 352


>AF236856-1|AAG17563.2|  370|Tribolium castaneum Kruppel protein
           protein.
          Length = 370

 Score = 21.0 bits (42), Expect = 8.8
 Identities = 15/48 (31%), Positives = 22/48 (45%), Gaps = 1/48 (2%)
 Frame = -1

Query: 519 IKSTTPLTDMLFDSVAPEVNIISFGSAFIKFATCSLAFSTAAS-LSHP 379
           ++ TTP  DML       ++ +S+ S F        +   AAS LS P
Sbjct: 4   LQETTPKRDMLDSQEKTPLSSVSYPSMFTPSQLLMASHLMAASRLSLP 51


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 159,265
Number of Sequences: 336
Number of extensions: 3487
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 16760905
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)