BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060803.seq (647 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. 22 3.8 AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein p... 22 3.8 AJ005421-1|CAA06527.1| 249|Tribolium castaneum caudal protein p... 22 3.8 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 6.6 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 21 6.6 >AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. Length = 247 Score = 22.2 bits (45), Expect = 3.8 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +3 Query: 321 VGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFA 431 VG + EG L E +GD G+L AS +FA Sbjct: 91 VGTALTFCLQEEGGTTSQLIELLGDAGKLL-ASVHFA 126 >AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein protein. Length = 287 Score = 22.2 bits (45), Expect = 3.8 Identities = 6/8 (75%), Positives = 6/8 (75%) Frame = -3 Query: 636 WQHHVHMP 613 W HH HMP Sbjct: 50 WHHHSHMP 57 >AJ005421-1|CAA06527.1| 249|Tribolium castaneum caudal protein protein. Length = 249 Score = 22.2 bits (45), Expect = 3.8 Identities = 6/8 (75%), Positives = 6/8 (75%) Frame = -3 Query: 636 WQHHVHMP 613 W HH HMP Sbjct: 50 WHHHSHMP 57 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 6.6 Identities = 5/11 (45%), Positives = 7/11 (63%) Frame = +2 Query: 419 WKLRHCDWTQS 451 W HCDW ++ Sbjct: 2271 WNKDHCDWPEN 2281 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 21.4 bits (43), Expect = 6.6 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -2 Query: 499 TFLAPDGSFTLVR 461 T PDG FT++R Sbjct: 579 TVTVPDGGFTIIR 591 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,820 Number of Sequences: 336 Number of extensions: 3690 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16656800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -