BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060803.seq (647 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 ... 25 0.63 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 25 0.83 DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 23 1.9 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 23 1.9 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 23 1.9 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 23 1.9 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 23 3.4 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 22 4.4 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 22 4.4 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 22 4.4 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 22 4.4 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 22 4.4 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 22 4.4 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 22 4.4 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 22 4.4 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 22 4.4 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 22 4.4 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 22 4.4 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 22 4.4 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 22 4.4 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 22 4.4 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 22 4.4 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 22 4.4 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 22 4.4 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 22 4.4 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 22 4.4 >AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 protein. Length = 134 Score = 25.0 bits (52), Expect = 0.63 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = +3 Query: 438 IGHNPDAKRTRVKLPSGAKKVLPSATEAWSVLLLE 542 IG+ + K+TR LP+G +KVL + VL+++ Sbjct: 57 IGYGSN-KKTRHMLPTGFRKVLVHNVKELEVLMMQ 90 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 24.6 bits (51), Expect = 0.83 Identities = 12/45 (26%), Positives = 19/45 (42%) Frame = +1 Query: 490 PRRFCHQQQRHGRYCCWRWTY*QTYFXSWKGIPQYKVKRNCWHMY 624 P C Q++RH R RWT + + + + + R W Y Sbjct: 5 PYARCIQERRHIRRELLRWTKNMVFVVGLERVAEELMGRRRWKQY 49 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 23.4 bits (48), Expect = 1.9 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -1 Query: 389 HFLFKIAHNGTLRHSSNRHHI 327 HF +I NGT+ + RH I Sbjct: 163 HFALRIYRNGTVNYLMRRHLI 183 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 23.4 bits (48), Expect = 1.9 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -1 Query: 389 HFLFKIAHNGTLRHSSNRHHI 327 HF +I NGT+ + RH I Sbjct: 163 HFALRIYRNGTVNYLMRRHLI 183 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 23.4 bits (48), Expect = 1.9 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -1 Query: 389 HFLFKIAHNGTLRHSSNRHHI 327 HF +I NGT+ + RH I Sbjct: 214 HFALRIYRNGTVNYLMRRHLI 234 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 23.4 bits (48), Expect = 1.9 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -1 Query: 389 HFLFKIAHNGTLRHSSNRHHI 327 HF +I NGT+ + RH I Sbjct: 163 HFALRIYRNGTVNYLMRRHLI 183 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 22.6 bits (46), Expect = 3.4 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +3 Query: 228 HTSSRQGRSLHCSR 269 HTSSR R CSR Sbjct: 226 HTSSRYSRERRCSR 239 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 22.2 bits (45), Expect = 4.4 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +3 Query: 228 HTSSRQGRSLHCSR 269 HTSSR R CSR Sbjct: 215 HTSSRYSRERSCSR 228 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 22.2 bits (45), Expect = 4.4 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +3 Query: 228 HTSSRQGRSLHCSR 269 HTSSR R CSR Sbjct: 215 HTSSRYSRERSCSR 228 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 22.2 bits (45), Expect = 4.4 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +3 Query: 228 HTSSRQGRSLHCSR 269 HTSSR R CSR Sbjct: 226 HTSSRYSRERSCSR 239 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.2 bits (45), Expect = 4.4 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +3 Query: 228 HTSSRQGRSLHCSR 269 HTSSR R CSR Sbjct: 226 HTSSRYSRERSCSR 239 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 22.2 bits (45), Expect = 4.4 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +3 Query: 228 HTSSRQGRSLHCSR 269 HTSSR R CSR Sbjct: 226 HTSSRYSRERSCSR 239 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 22.2 bits (45), Expect = 4.4 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +3 Query: 228 HTSSRQGRSLHCSR 269 HTSSR R CSR Sbjct: 215 HTSSRYSRERSCSR 228 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.2 bits (45), Expect = 4.4 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +3 Query: 228 HTSSRQGRSLHCSR 269 HTSSR R CSR Sbjct: 226 HTSSRYSRERSCSR 239 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.2 bits (45), Expect = 4.4 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +3 Query: 228 HTSSRQGRSLHCSR 269 HTSSR R CSR Sbjct: 226 HTSSRYSRERSCSR 239 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 22.2 bits (45), Expect = 4.4 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +3 Query: 228 HTSSRQGRSLHCSR 269 HTSSR R CSR Sbjct: 215 HTSSRYSRERSCSR 228 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.2 bits (45), Expect = 4.4 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +3 Query: 228 HTSSRQGRSLHCSR 269 HTSSR R CSR Sbjct: 226 HTSSRYSRERSCSR 239 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 22.2 bits (45), Expect = 4.4 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +3 Query: 228 HTSSRQGRSLHCSR 269 HTSSR R CSR Sbjct: 226 HTSSRYSRERSCSR 239 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 22.2 bits (45), Expect = 4.4 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +3 Query: 228 HTSSRQGRSLHCSR 269 HTSSR R CSR Sbjct: 226 HTSSRYSRERSCSR 239 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 22.2 bits (45), Expect = 4.4 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +3 Query: 228 HTSSRQGRSLHCSR 269 HTSSR R CSR Sbjct: 226 HTSSRYSRERSCSR 239 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 22.2 bits (45), Expect = 4.4 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +3 Query: 228 HTSSRQGRSLHCSR 269 HTSSR R CSR Sbjct: 215 HTSSRYSRERSCSR 228 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 22.2 bits (45), Expect = 4.4 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +3 Query: 228 HTSSRQGRSLHCSR 269 HTSSR R CSR Sbjct: 231 HTSSRYSRERSCSR 244 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 22.2 bits (45), Expect = 4.4 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +3 Query: 228 HTSSRQGRSLHCSR 269 HTSSR R CSR Sbjct: 226 HTSSRYSRERSCSR 239 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 22.2 bits (45), Expect = 4.4 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +3 Query: 228 HTSSRQGRSLHCSR 269 HTSSR R CSR Sbjct: 226 HTSSRYSRERSCSR 239 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 22.2 bits (45), Expect = 4.4 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +3 Query: 228 HTSSRQGRSLHCSR 269 HTSSR R CSR Sbjct: 226 HTSSRYSRERSCSR 239 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 22.2 bits (45), Expect = 4.4 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +3 Query: 228 HTSSRQGRSLHCSR 269 HTSSR R CSR Sbjct: 226 HTSSRYSRERSCSR 239 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,937 Number of Sequences: 438 Number of extensions: 4399 Number of successful extensions: 28 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19560480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -