BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060799.seq (645 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 49 3e-08 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 21 7.7 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 49.2 bits (112), Expect = 3e-08 Identities = 23/52 (44%), Positives = 30/52 (57%) Frame = +1 Query: 352 NNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAM 507 +N +V VSG V PI+ FE A + V +K GYK+PTP+Q PI M Sbjct: 180 DNIQVNVSGDNVPQPIESFEAAGLRNIVLDNIKKSGYKKPTPVQKHALPIIM 231 Score = 28.7 bits (61), Expect = 0.051 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +3 Query: 447 KDNGLQRTDAYSSSRLADSYVGKNLVGVLKTGSGKTLAYILPAI 578 K +G ++ L G++L+ +TGSGKT A+ +P I Sbjct: 212 KKSGYKKPTPVQKHALPIIMNGRDLMACAQTGSGKTAAFAVPII 255 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.4 bits (43), Expect = 7.7 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +3 Query: 93 TGIIAVETVVPNLEEATNSA 152 T + A V P +EE TN+A Sbjct: 412 TALGAAALVAPGMEEPTNTA 431 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,624 Number of Sequences: 438 Number of extensions: 3392 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19438227 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -