BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060794.seq (631 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR457161-1|CAG33442.1| 599|Homo sapiens SCMH1 protein. 30 7.8 BC021252-1|AAH21252.1| 599|Homo sapiens SCMH1 protein protein. 30 7.8 BC009752-1|AAH09752.1| 660|Homo sapiens sex comb on midleg homo... 30 7.8 AL606484-1|CAH72242.1| 648|Homo sapiens sex comb on midleg homo... 30 7.8 AL391730-7|CAH72796.1| 577|Homo sapiens sex comb on midleg homo... 30 7.8 AL391730-6|CAH72795.1| 599|Homo sapiens sex comb on midleg homo... 30 7.8 AL391730-5|CAH72794.1| 648|Homo sapiens sex comb on midleg homo... 30 7.8 AL391730-4|CAH72793.1| 660|Homo sapiens sex comb on midleg homo... 30 7.8 AL391730-2|CAH72791.1| 591|Homo sapiens sex comb on midleg homo... 30 7.8 AL110502-5|CAI22112.1| 577|Homo sapiens sex comb on midleg homo... 30 7.8 AL110502-4|CAI22113.1| 599|Homo sapiens sex comb on midleg homo... 30 7.8 AL110502-3|CAI22111.1| 648|Homo sapiens sex comb on midleg homo... 30 7.8 AL110502-2|CAI22110.1| 660|Homo sapiens sex comb on midleg homo... 30 7.8 AL110502-1|CAI22109.1| 591|Homo sapiens sex comb on midleg homo... 30 7.8 AF149046-1|AAF01151.1| 577|Homo sapiens Sex comb on midleg homo... 30 7.8 AF149045-1|AAF01150.1| 591|Homo sapiens Sex comb on midleg homo... 30 7.8 >CR457161-1|CAG33442.1| 599|Homo sapiens SCMH1 protein. Length = 599 Score = 29.9 bits (64), Expect = 7.8 Identities = 16/42 (38%), Positives = 24/42 (57%) Frame = -1 Query: 226 VYFLLKEPHGRLVPSSNINRSKYTLNVFKKNLITVFISFFLK 101 V+ LK+ HG V S+ +R ++TLN+ N IT + F K Sbjct: 350 VFSFLKQGHGGEVISAVFDREQHTLNLPAVNSITYVLRFLEK 391 >BC021252-1|AAH21252.1| 599|Homo sapiens SCMH1 protein protein. Length = 599 Score = 29.9 bits (64), Expect = 7.8 Identities = 16/42 (38%), Positives = 24/42 (57%) Frame = -1 Query: 226 VYFLLKEPHGRLVPSSNINRSKYTLNVFKKNLITVFISFFLK 101 V+ LK+ HG V S+ +R ++TLN+ N IT + F K Sbjct: 350 VFSFLKQGHGGEVISAVFDREQHTLNLPAVNSITYVLRFLEK 391 >BC009752-1|AAH09752.1| 660|Homo sapiens sex comb on midleg homolog 1 (Drosophila) protein. Length = 660 Score = 29.9 bits (64), Expect = 7.8 Identities = 16/42 (38%), Positives = 24/42 (57%) Frame = -1 Query: 226 VYFLLKEPHGRLVPSSNINRSKYTLNVFKKNLITVFISFFLK 101 V+ LK+ HG V S+ +R ++TLN+ N IT + F K Sbjct: 411 VFSFLKQGHGGEVISAVFDREQHTLNLPAVNSITYVLRFLEK 452 >AL606484-1|CAH72242.1| 648|Homo sapiens sex comb on midleg homolog 1 (Drosophila) protein. Length = 648 Score = 29.9 bits (64), Expect = 7.8 Identities = 16/42 (38%), Positives = 24/42 (57%) Frame = -1 Query: 226 VYFLLKEPHGRLVPSSNINRSKYTLNVFKKNLITVFISFFLK 101 V+ LK+ HG V S+ +R ++TLN+ N IT + F K Sbjct: 421 VFSFLKQGHGGEVISAVFDREQHTLNLPAVNSITYVLRFLEK 462 >AL391730-7|CAH72796.1| 577|Homo sapiens sex comb on midleg homolog 1 (Drosophila) protein. Length = 577 Score = 29.9 bits (64), Expect = 7.8 Identities = 16/42 (38%), Positives = 24/42 (57%) Frame = -1 Query: 226 VYFLLKEPHGRLVPSSNINRSKYTLNVFKKNLITVFISFFLK 101 V+ LK+ HG V S+ +R ++TLN+ N IT + F K Sbjct: 350 VFSFLKQGHGGEVISAVFDREQHTLNLPAVNSITYVLRFLEK 391 >AL391730-6|CAH72795.1| 599|Homo sapiens sex comb on midleg homolog 1 (Drosophila) protein. Length = 599 Score = 29.9 bits (64), Expect = 7.8 Identities = 16/42 (38%), Positives = 24/42 (57%) Frame = -1 Query: 226 VYFLLKEPHGRLVPSSNINRSKYTLNVFKKNLITVFISFFLK 101 V+ LK+ HG V S+ +R ++TLN+ N IT + F K Sbjct: 350 VFSFLKQGHGGEVISAVFDREQHTLNLPAVNSITYVLRFLEK 391 >AL391730-5|CAH72794.1| 648|Homo sapiens sex comb on midleg homolog 1 (Drosophila) protein. Length = 648 Score = 29.9 bits (64), Expect = 7.8 Identities = 16/42 (38%), Positives = 24/42 (57%) Frame = -1 Query: 226 VYFLLKEPHGRLVPSSNINRSKYTLNVFKKNLITVFISFFLK 101 V+ LK+ HG V S+ +R ++TLN+ N IT + F K Sbjct: 421 VFSFLKQGHGGEVISAVFDREQHTLNLPAVNSITYVLRFLEK 462 >AL391730-4|CAH72793.1| 660|Homo sapiens sex comb on midleg homolog 1 (Drosophila) protein. Length = 660 Score = 29.9 bits (64), Expect = 7.8 Identities = 16/42 (38%), Positives = 24/42 (57%) Frame = -1 Query: 226 VYFLLKEPHGRLVPSSNINRSKYTLNVFKKNLITVFISFFLK 101 V+ LK+ HG V S+ +R ++TLN+ N IT + F K Sbjct: 411 VFSFLKQGHGGEVISAVFDREQHTLNLPAVNSITYVLRFLEK 452 >AL391730-2|CAH72791.1| 591|Homo sapiens sex comb on midleg homolog 1 (Drosophila) protein. Length = 591 Score = 29.9 bits (64), Expect = 7.8 Identities = 16/42 (38%), Positives = 24/42 (57%) Frame = -1 Query: 226 VYFLLKEPHGRLVPSSNINRSKYTLNVFKKNLITVFISFFLK 101 V+ LK+ HG V S+ +R ++TLN+ N IT + F K Sbjct: 364 VFSFLKQGHGGEVISAVFDREQHTLNLPAVNSITYVLRFLEK 405 >AL110502-5|CAI22112.1| 577|Homo sapiens sex comb on midleg homolog 1 (Drosophila) protein. Length = 577 Score = 29.9 bits (64), Expect = 7.8 Identities = 16/42 (38%), Positives = 24/42 (57%) Frame = -1 Query: 226 VYFLLKEPHGRLVPSSNINRSKYTLNVFKKNLITVFISFFLK 101 V+ LK+ HG V S+ +R ++TLN+ N IT + F K Sbjct: 350 VFSFLKQGHGGEVISAVFDREQHTLNLPAVNSITYVLRFLEK 391 >AL110502-4|CAI22113.1| 599|Homo sapiens sex comb on midleg homolog 1 (Drosophila) protein. Length = 599 Score = 29.9 bits (64), Expect = 7.8 Identities = 16/42 (38%), Positives = 24/42 (57%) Frame = -1 Query: 226 VYFLLKEPHGRLVPSSNINRSKYTLNVFKKNLITVFISFFLK 101 V+ LK+ HG V S+ +R ++TLN+ N IT + F K Sbjct: 350 VFSFLKQGHGGEVISAVFDREQHTLNLPAVNSITYVLRFLEK 391 >AL110502-3|CAI22111.1| 648|Homo sapiens sex comb on midleg homolog 1 (Drosophila) protein. Length = 648 Score = 29.9 bits (64), Expect = 7.8 Identities = 16/42 (38%), Positives = 24/42 (57%) Frame = -1 Query: 226 VYFLLKEPHGRLVPSSNINRSKYTLNVFKKNLITVFISFFLK 101 V+ LK+ HG V S+ +R ++TLN+ N IT + F K Sbjct: 421 VFSFLKQGHGGEVISAVFDREQHTLNLPAVNSITYVLRFLEK 462 >AL110502-2|CAI22110.1| 660|Homo sapiens sex comb on midleg homolog 1 (Drosophila) protein. Length = 660 Score = 29.9 bits (64), Expect = 7.8 Identities = 16/42 (38%), Positives = 24/42 (57%) Frame = -1 Query: 226 VYFLLKEPHGRLVPSSNINRSKYTLNVFKKNLITVFISFFLK 101 V+ LK+ HG V S+ +R ++TLN+ N IT + F K Sbjct: 411 VFSFLKQGHGGEVISAVFDREQHTLNLPAVNSITYVLRFLEK 452 >AL110502-1|CAI22109.1| 591|Homo sapiens sex comb on midleg homolog 1 (Drosophila) protein. Length = 591 Score = 29.9 bits (64), Expect = 7.8 Identities = 16/42 (38%), Positives = 24/42 (57%) Frame = -1 Query: 226 VYFLLKEPHGRLVPSSNINRSKYTLNVFKKNLITVFISFFLK 101 V+ LK+ HG V S+ +R ++TLN+ N IT + F K Sbjct: 364 VFSFLKQGHGGEVISAVFDREQHTLNLPAVNSITYVLRFLEK 405 >AF149046-1|AAF01151.1| 577|Homo sapiens Sex comb on midleg homolog 1 isoform 2 protein. Length = 577 Score = 29.9 bits (64), Expect = 7.8 Identities = 16/42 (38%), Positives = 24/42 (57%) Frame = -1 Query: 226 VYFLLKEPHGRLVPSSNINRSKYTLNVFKKNLITVFISFFLK 101 V+ LK+ HG V S+ +R ++TLN+ N IT + F K Sbjct: 350 VFSFLKQGHGGEVISAVFDREQHTLNLPAVNSITYVLRFLEK 391 >AF149045-1|AAF01150.1| 591|Homo sapiens Sex comb on midleg homolog 1 isoform 1 protein. Length = 591 Score = 29.9 bits (64), Expect = 7.8 Identities = 16/42 (38%), Positives = 24/42 (57%) Frame = -1 Query: 226 VYFLLKEPHGRLVPSSNINRSKYTLNVFKKNLITVFISFFLK 101 V+ LK+ HG V S+ +R ++TLN+ N IT + F K Sbjct: 364 VFSFLKQGHGGEVISAVFDREQHTLNLPAVNSITYVLRFLEK 405 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 82,695,737 Number of Sequences: 237096 Number of extensions: 1523845 Number of successful extensions: 2528 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 2500 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2528 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6860268620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -