BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060791.seq (460 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292377-1|CAL23189.2| 358|Tribolium castaneum gustatory recept... 22 2.4 AM292342-1|CAL23154.2| 386|Tribolium castaneum gustatory recept... 22 2.4 >AM292377-1|CAL23189.2| 358|Tribolium castaneum gustatory receptor candidate 56 protein. Length = 358 Score = 22.2 bits (45), Expect = 2.4 Identities = 14/52 (26%), Positives = 22/52 (42%) Frame = -1 Query: 271 RYYFPTFSLKFSICSSSQGILKASXYFSESNNLETIATIFTDSFMFLSHPKH 116 RY+ FS S CS G + A N+E + F +++ + KH Sbjct: 89 RYFEEVFSSLLSCCSVIFGCIFALKVIEVFKNIEEVDVAFRSLAVWVPY-KH 139 >AM292342-1|CAL23154.2| 386|Tribolium castaneum gustatory receptor candidate 21 protein. Length = 386 Score = 22.2 bits (45), Expect = 2.4 Identities = 14/52 (26%), Positives = 22/52 (42%) Frame = -1 Query: 271 RYYFPTFSLKFSICSSSQGILKASXYFSESNNLETIATIFTDSFMFLSHPKH 116 RY+ FS S CS G + A N+E + F +++ + KH Sbjct: 89 RYFEEVFSSLLSCCSVIFGCIFALKVIEVFKNIEEVDVAFRSLAVWVPY-KH 139 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 91,314 Number of Sequences: 336 Number of extensions: 1755 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10511300 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -