BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060790.seq (642 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0727 - 6010537-6010548,6011029-6011606,6011709-6011774,601... 32 0.45 01_01_1124 + 8916863-8917090,8917745-8917936,8918115-8918280,891... 30 1.8 06_01_0889 - 6807449-6809257 29 4.1 07_01_0516 - 3850252-3852870 28 5.5 08_01_0269 - 2172363-2172538,2172632-2172697,2172790-2172887,217... 28 7.2 09_01_0161 + 2401945-2402218,2402469-2402563,2402936-2403070,240... 27 9.6 01_06_1635 - 38794215-38794325,38794434-38794579,38796845-387968... 27 9.6 >11_01_0727 - 6010537-6010548,6011029-6011606,6011709-6011774, 6011867-6011964,6013238-6013608 Length = 374 Score = 31.9 bits (69), Expect = 0.45 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = +1 Query: 109 FPTPAYSHHIVYKVYIEALAEKCHNVTVVKPKLFAYSTKTYCG 237 FP P + + + Y++ LA+ + K +++A+ST TY G Sbjct: 100 FPDPKPTREEMIETYLQTLAKVVGSYEEAKKRMYAFSTTTYVG 142 >01_01_1124 + 8916863-8917090,8917745-8917936,8918115-8918280, 8918373-8918794 Length = 335 Score = 29.9 bits (64), Expect = 1.8 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -2 Query: 410 AHVDIVKLVFEHFNQAQVVGGGYRVCIGHHSALSKHCR 297 A+ D V L F+HF Q+ V G G + K+CR Sbjct: 291 AYADDVNLFFKHFAQSMVNMGNISPLTGSQGEIRKNCR 328 >06_01_0889 - 6807449-6809257 Length = 602 Score = 28.7 bits (61), Expect = 4.1 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Frame = +3 Query: 321 VVSDTDTVTAANYLGLIEMFKDQFDNINVRNLIA-NNQTFDLVVVEAFADYALVFGHL 491 VVS T V LGL++ ++ FD + RNL++ N+ V + F D VF + Sbjct: 164 VVSWTTMVGGLCRLGLVDDAREVFDAMPARNLVSWNSMISGYVKADRFLDALEVFDEM 221 >07_01_0516 - 3850252-3852870 Length = 872 Score = 28.3 bits (60), Expect = 5.5 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +3 Query: 315 RGVVSDTDTVTAANYLGLIEMFKDQFDNINVRNLIANN 428 + V+S T + GL++M D FD + VRN + N Sbjct: 317 KDVISWTGLLNGYMEFGLVDMAMDVFDRMPVRNFVTYN 354 >08_01_0269 - 2172363-2172538,2172632-2172697,2172790-2172887, 2173442-2173791 Length = 229 Score = 27.9 bits (59), Expect = 7.2 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = +1 Query: 97 ILAVFPT-PAYSHHIVYKVYIEALAEKCHNVTVVKPKLFAYSTKTYCG 237 I+ FP PA + + Y+ LA ++ K ++A+ST TY G Sbjct: 88 IVMEFPKDPAPTREQMIDTYLNTLATVLGSMEEAKKNMYAFSTTTYTG 135 >09_01_0161 + 2401945-2402218,2402469-2402563,2402936-2403070, 2403176-2403865 Length = 397 Score = 27.5 bits (58), Expect = 9.6 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +2 Query: 161 PLPKNVTTLRSSSPNCLRIRP 223 PLP+N T +S P LR+RP Sbjct: 159 PLPENPTLAQSKLPEFLRVRP 179 >01_06_1635 - 38794215-38794325,38794434-38794579,38796845-38796898, 38796999-38797167 Length = 159 Score = 27.5 bits (58), Expect = 9.6 Identities = 26/95 (27%), Positives = 43/95 (45%), Gaps = 5/95 (5%) Frame = -1 Query: 348 RLPCLYRTPL-RAF*TLPNSLLVSCIA*PTCRINFRNITAISFGRIRKQFGLDDR----N 184 R P L R L F L LL++ +A PT + +T ++ + + LD + Sbjct: 8 RSPVLPRRRLAEPFLLLLLLLLLAAVARPTAAADVVELTLLAGAQEKGAVCLDGSPPGYH 67 Query: 183 VVTFFGKGFNIHFVDYMVAVSWRRKHGQYIDRIYS 79 + FG GF FVD + V ++ G +ID ++ Sbjct: 68 LQRGFGSGFRNKFVDDVEIVKDKKDWGLFIDSCFT 102 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,576,958 Number of Sequences: 37544 Number of extensions: 410598 Number of successful extensions: 1020 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 999 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1020 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1584867848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -