BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060790.seq (642 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_1493| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.34 SB_10016| Best HMM Match : FliG_C (HMM E-Value=0.6) 29 2.4 SB_15366| Best HMM Match : rve (HMM E-Value=0.00011) 29 3.2 SB_33371| Best HMM Match : SRF-TF (HMM E-Value=2.4e-24) 24 4.0 SB_59352| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_45719| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_28353| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_12590| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_45181| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_43726| Best HMM Match : zf-C2H2 (HMM E-Value=3.5e-31) 28 7.4 SB_8953| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 >SB_1493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 741 Score = 32.3 bits (70), Expect = 0.34 Identities = 16/47 (34%), Positives = 23/47 (48%) Frame = +3 Query: 15 VIRVEAKNDYSLLACTAVYAYCCKCGQYIGRVSYASLQPPYSLQSVY 155 V+R E KN+ + + Y CG Y GRV +L PP+ V+ Sbjct: 20 VLRKEKKNNSHWVFGNVFFKYRKSCGAYEGRVCKPNLTPPFGRVKVH 66 >SB_10016| Best HMM Match : FliG_C (HMM E-Value=0.6) Length = 198 Score = 29.5 bits (63), Expect = 2.4 Identities = 13/50 (26%), Positives = 28/50 (56%) Frame = +3 Query: 285 LVTNSAMFRKRGVVSDTDTVTAANYLGLIEMFKDQFDNINVRNLIANNQT 434 L T + R++ +V DT+ + NY G++++F + N+ +R+ + T Sbjct: 86 LATKQSKVRRQKLVFKHDTLLSVNYFGVLKIFSGE-RNLQLRSSLVEGTT 134 >SB_15366| Best HMM Match : rve (HMM E-Value=0.00011) Length = 1178 Score = 29.1 bits (62), Expect = 3.2 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = +1 Query: 55 LALLSTLTAVNAVNILAVFPTPAYSHHIVYKVYIEALAEKCHNV 186 LA AV A+ + +FP AY+H YK+ + L H + Sbjct: 990 LAACCDAAAVQALRLGGLFPYCAYTHAYTYKMIADQLWSAMHEI 1033 >SB_33371| Best HMM Match : SRF-TF (HMM E-Value=2.4e-24) Length = 333 Score = 24.2 bits (50), Expect(2) = 4.0 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +3 Query: 57 CTAVYAYCCKC 89 CT +YAY C C Sbjct: 255 CTRIYAYVCAC 265 Score = 23.0 bits (47), Expect(2) = 4.0 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +3 Query: 54 ACTAVYAYCC 83 ACT +YAY C Sbjct: 246 ACTCIYAYLC 255 >SB_59352| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 879 Score = 28.7 bits (61), Expect = 4.2 Identities = 19/64 (29%), Positives = 34/64 (53%), Gaps = 6/64 (9%) Frame = +3 Query: 183 RYGRQAQTVCVFDQNLLR*YYGS*SDMSVKQYKKL------VTNSAMFRKRGVVSDTDTV 344 R Q T+ V + +L+ Y S ++V+QYK L +T+S+++R G+V + D + Sbjct: 156 RLQNQTATIKVNLKRMLK-YKSSALSLNVRQYKVLQAANWLITHSSLYRDEGIVLNNDWI 214 Query: 345 TAAN 356 N Sbjct: 215 NQYN 218 >SB_45719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 429 Score = 28.7 bits (61), Expect = 4.2 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +3 Query: 258 DMSVKQYKKLVTNSAMFRKRGVVSDTDTVTAA 353 D+ ++QYK +V N R RG+ DTD+ T A Sbjct: 234 DIEIEQYKDMV-NGLQQRIRGLEMDTDSTTMA 264 >SB_28353| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 28.3 bits (60), Expect = 5.6 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +1 Query: 511 PNRAWLRFGGKL*TR*APWRGNPVHHPNIWRNNFDDT 621 P R +FG + T A W+ H PN + +FDD+ Sbjct: 35 PGRIMAKFGNGIETD-AEWKCTNKHSPNFQKTDFDDS 70 >SB_12590| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 760 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/51 (27%), Positives = 25/51 (49%) Frame = +1 Query: 55 LALLSTLTAVNAVNILAVFPTPAYSHHIVYKVYIEALAEKCHNVTVVKPKL 207 LA AV A+++ +FP AY++ YK+ + L H+V ++ Sbjct: 387 LAACCDAAAVPALHLGGLFPYCAYTYTYTYKIIADQLWSAMHDVAAAAKRV 437 >SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2973 Score = 28.3 bits (60), Expect = 5.6 Identities = 15/51 (29%), Positives = 24/51 (47%) Frame = +1 Query: 55 LALLSTLTAVNAVNILAVFPTPAYSHHIVYKVYIEALAEKCHNVTVVKPKL 207 LA AV A+++ +FP AYS+ YK+ + L H V ++ Sbjct: 1227 LAACCDAAAVPALHLGGLFPYCAYSYTYTYKMIADQLWSAMHEVAAAAKRV 1277 >SB_45181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 747 Score = 27.9 bits (59), Expect = 7.4 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = -1 Query: 144 VDYMVAVSWRRKHGQYIDRIYSSKRRQQCKPAK 46 V YM A SW +H Q I + K+ Q KP K Sbjct: 361 VRYMTA-SWTTRHSQSISKSNMDKQAQSIKPKK 392 >SB_43726| Best HMM Match : zf-C2H2 (HMM E-Value=3.5e-31) Length = 516 Score = 27.9 bits (59), Expect = 7.4 Identities = 16/41 (39%), Positives = 20/41 (48%) Frame = -1 Query: 141 DYMVAVSWRRKHGQYIDRIYSSKRRQQCKPAKNSHFLLQPE 19 DY+ + S H Y D + SS R QC P N L QP+ Sbjct: 188 DYLGSSSLAHGHAMY-DSLGSSSRYPQCPPGFNPLALHQPK 227 >SB_8953| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 328 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/44 (29%), Positives = 25/44 (56%) Frame = +1 Query: 91 VNILAVFPTPAYSHHIVYKVYIEALAEKCHNVTVVKPKLFAYST 222 + + +VF P ++ H+V V EAL + + + +V+ LF S+ Sbjct: 242 IGVFSVFCLPFFTFHVVDAVTEEALENRFYALNIVQWLLFLNSS 285 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,303,467 Number of Sequences: 59808 Number of extensions: 465125 Number of successful extensions: 1075 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 998 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1075 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1620947750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -