BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060790.seq (642 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein ... 24 1.1 AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein ... 24 1.1 DQ855486-1|ABH88173.1| 104|Apis mellifera chemosensory protein ... 24 1.4 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 23 1.9 AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter... 23 1.9 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 2.5 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 22 5.8 DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 21 7.7 >DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein 1 protein. Length = 116 Score = 24.2 bits (50), Expect = 1.1 Identities = 6/20 (30%), Positives = 16/20 (80%) Frame = +3 Query: 372 EMFKDQFDNINVRNLIANNQ 431 E++ D++D +N+ ++AN++ Sbjct: 21 ELYSDKYDYVNIDEILANDR 40 >AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein protein. Length = 116 Score = 24.2 bits (50), Expect = 1.1 Identities = 6/20 (30%), Positives = 16/20 (80%) Frame = +3 Query: 372 EMFKDQFDNINVRNLIANNQ 431 E++ D++D +N+ ++AN++ Sbjct: 21 ELYSDKYDYVNIDEILANDR 40 >DQ855486-1|ABH88173.1| 104|Apis mellifera chemosensory protein 5 protein. Length = 104 Score = 23.8 bits (49), Expect = 1.4 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = -3 Query: 355 LAAVTVSVSDTTPRFLNIAEFVTSFLYCLTD 263 LA + V D +FL +V L+C+ D Sbjct: 12 LALINVKAQDDISKFLKDRPYVQKQLHCILD 42 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 23.4 bits (48), Expect = 1.9 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = -1 Query: 531 P*PGAIWIRAQDRTGGQTPTHNRQTLP 451 P P IW+RA G P RQ LP Sbjct: 31 PQPDIIWVRADGSAVGDVP-GLRQVLP 56 >AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter Am-EAAT protein. Length = 543 Score = 23.4 bits (48), Expect = 1.9 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -1 Query: 240 ITAISFGRIRKQFGLDDRNVVTFF 169 + I+FG + QFG + +V FF Sbjct: 245 VFCITFGLVAGQFGAQGKLIVDFF 268 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 23.0 bits (47), Expect = 2.5 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -1 Query: 117 RRKHGQYIDRIYSSKRRQQCKPAKNSHFL 31 RR+ QY D +YS R + A+ H L Sbjct: 43 RRRWKQYQDTLYSGTRSSESLTAQAHHRL 71 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 21.8 bits (44), Expect = 5.8 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +1 Query: 499 LRPYPNRAWLRFG 537 LRPYPN W G Sbjct: 228 LRPYPNWEWHTVG 240 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 21.4 bits (43), Expect = 7.7 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = +1 Query: 496 ILRPYPNRAWLR 531 +L PYPN +W + Sbjct: 104 LLEPYPNWSWAK 115 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 189,401 Number of Sequences: 438 Number of extensions: 4555 Number of successful extensions: 13 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19315974 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -