BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060787.seq (655 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 22 6.0 AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 22 6.0 AB095513-1|BAC76335.1| 39|Apis mellifera brood-complex protein. 22 6.0 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 7.9 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 7.9 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 21.8 bits (44), Expect = 6.0 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +1 Query: 571 SNRRAVWIPRQTLVRTTS 624 SN + IPR +LV TTS Sbjct: 732 SNNSQLQIPRASLVSTTS 749 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 21.8 bits (44), Expect = 6.0 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -3 Query: 515 FCHRWEETNRTVTSGF 468 FC RW ++TS F Sbjct: 7 FCLRWNNYQSSITSAF 22 >AB095513-1|BAC76335.1| 39|Apis mellifera brood-complex protein. Length = 39 Score = 21.8 bits (44), Expect = 6.0 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -3 Query: 515 FCHRWEETNRTVTSGF 468 FC RW ++TS F Sbjct: 7 FCLRWNNYQSSITSAF 22 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.4 bits (43), Expect = 7.9 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = +3 Query: 198 RGGRAQSFPATLGRVTPHYSDEVREVIDNLQPKKAPGSD 314 +GG+ + P+T RVT VI LQ A SD Sbjct: 843 KGGKIELNPSTNYRVTVKREVTPDGVIAQLQISSAEASD 881 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.4 bits (43), Expect = 7.9 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = +3 Query: 198 RGGRAQSFPATLGRVTPHYSDEVREVIDNLQPKKAPGSD 314 +GG+ + P+T RVT VI LQ A SD Sbjct: 839 KGGKIELNPSTNYRVTVKREVTPDGVIAQLQISSAEASD 877 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 178,566 Number of Sequences: 438 Number of extensions: 3553 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19804986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -