BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060786.seq (639 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 25 2.0 L20837-1|AAA03087.1| 192|Anopheles gambiae ribosomal protein S7... 24 4.7 U03849-1|AAA53488.1| 388|Anopheles gambiae putative nucleic aci... 23 8.2 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 25.0 bits (52), Expect = 2.0 Identities = 13/39 (33%), Positives = 16/39 (41%) Frame = -1 Query: 615 FGGTLVYSLSRCCTEVIAPSTERRFTRDLILEAVPNHQP 499 FG + LSR P TER ++ E P H P Sbjct: 417 FGAGYLVVLSRLRGGRAPPETERARLESIVTELFPQHPP 455 >L20837-1|AAA03087.1| 192|Anopheles gambiae ribosomal protein S7 protein. Length = 192 Score = 23.8 bits (49), Expect = 4.7 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +1 Query: 7 RSFVQRHLLFL*CLNFVFHMLRGNRNKKKSKNPRT 111 + F +H++F+ + +RG R+ K K PR+ Sbjct: 83 KKFSGKHVVFIAERRILPKPMRGRRDPNKQKRPRS 117 >U03849-1|AAA53488.1| 388|Anopheles gambiae putative nucleic acid binding protein protein. Length = 388 Score = 23.0 bits (47), Expect = 8.2 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +2 Query: 62 TCLGVTEIRKNPRIPAQEEKSEQ 130 +C+G T + KNPR + +E Q Sbjct: 63 SCIGCTNMLKNPRCRSVKEIGAQ 85 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 666,884 Number of Sequences: 2352 Number of extensions: 12583 Number of successful extensions: 27 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62723250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -