BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060785.seq (639 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 26 0.27 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 23 3.3 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 21 7.6 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 26.2 bits (55), Expect = 0.27 Identities = 12/43 (27%), Positives = 23/43 (53%) Frame = -3 Query: 370 EARGGRKNDSFKIDKIRVAVAFDDGGDVR**LHSDTVRLVSVP 242 E +K D ID +++ + DDG D+ + + R++S+P Sbjct: 323 EEENDKKLDLDSIDMMQLPIQLDDGIDILDDVKCEDERVISIP 365 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 22.6 bits (46), Expect = 3.3 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +3 Query: 579 FPSIPWWRTRRS 614 FP+I WWR R+ Sbjct: 179 FPAIVWWRAVRT 190 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 21.4 bits (43), Expect = 7.6 Identities = 16/75 (21%), Positives = 35/75 (46%), Gaps = 6/75 (8%) Frame = +2 Query: 239 YWHRNQSNSVTVQSLPNVSSIIKGY-----RDAY-LVNLEAVVFPSAPSLKIPVTVDLCW 400 Y +R Q+ + ++P S I+ R Y L+++ +V + + + +D+CW Sbjct: 34 YSNRTQALESIIANIPTWLSFIRIVLVILLRAGYVLIHIGSVPVNNINLILLQNIIDICW 93 Query: 401 TTADVTVEGVNVLAT 445 T ++ G+ + T Sbjct: 94 ITMVYSLLGIIIAYT 108 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,308 Number of Sequences: 438 Number of extensions: 3572 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19193721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -