BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060784.seq (642 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory recept... 23 2.8 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 22 4.9 >AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory receptor candidate 54 protein. Length = 311 Score = 22.6 bits (46), Expect = 2.8 Identities = 7/42 (16%), Positives = 25/42 (59%) Frame = -3 Query: 496 QRWHAVSQ*SELLEAKRNKRIESFKVFVKCLSVEYSFLVVLW 371 ++W ++++ + ++ K N R +VF + ++ ++ ++ L+ Sbjct: 44 EQWSSLNKNFQFIDKKLNNRNSKSRVFYENVNFQFGSILALF 85 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 21.8 bits (44), Expect = 4.9 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -3 Query: 217 QPQSASWCGRSGLHASPYVN 158 +P A G GLH SP++N Sbjct: 27 EPHVAHRPGLQGLHHSPHLN 46 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 138,776 Number of Sequences: 336 Number of extensions: 2877 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16448590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -