BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060780.seq (448 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC19G7.03c |rps3002|rps30-2, rps30|40S ribosomal protein S30|S... 41 1e-04 SPAC19B12.04 |rps3001|rps30-1|40S ribosomal protein S30|Schizosa... 41 1e-04 SPCC1840.12 ||SPCC965.02|OPT oligopeptide transporter family|Sch... 26 3.0 SPAC31A2.12 |||arrestin/PY protein 1|Schizosaccharomyces pombe|c... 26 3.0 SPAC1002.16c |||nicotinic acid plasma membrane transporter |Schi... 24 9.3 SPBC902.02c |ctf18|chl12|DNA replication factor C complex subuni... 24 9.3 >SPBC19G7.03c |rps3002|rps30-2, rps30|40S ribosomal protein S30|Schizosaccharomyces pombe|chr 2|||Manual Length = 61 Score = 40.7 bits (91), Expect = 1e-04 Identities = 23/48 (47%), Positives = 26/48 (54%), Gaps = 2/48 (4%) Frame = +1 Query: 256 VKGQTPKVEXXXXXXXXTGRAKRRIQYNRRFVNVVQTFG--RXXGPNS 393 VK QTPKVE GRA +R+ Y RRFVNV G R P+S Sbjct: 14 VKSQTPKVEKQEKPKQPKGRAYKRLLYVRRFVNVTNMVGGKRRMNPSS 61 Score = 26.6 bits (56), Expect = 1.7 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 221 GKVHGSLARAG 253 GKVHGSLARAG Sbjct: 2 GKVHGSLARAG 12 >SPAC19B12.04 |rps3001|rps30-1|40S ribosomal protein S30|Schizosaccharomyces pombe|chr 1|||Manual Length = 61 Score = 40.7 bits (91), Expect = 1e-04 Identities = 23/48 (47%), Positives = 26/48 (54%), Gaps = 2/48 (4%) Frame = +1 Query: 256 VKGQTPKVEXXXXXXXXTGRAKRRIQYNRRFVNVVQTFG--RXXGPNS 393 VK QTPKVE GRA +R+ Y RRFVNV G R P+S Sbjct: 14 VKSQTPKVEKQEKPKQPKGRAYKRLLYVRRFVNVTNMVGGKRRMNPSS 61 Score = 26.6 bits (56), Expect = 1.7 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 221 GKVHGSLARAG 253 GKVHGSLARAG Sbjct: 2 GKVHGSLARAG 12 >SPCC1840.12 ||SPCC965.02|OPT oligopeptide transporter family|Schizosaccharomyces pombe|chr 3|||Manual Length = 791 Score = 25.8 bits (54), Expect = 3.0 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -1 Query: 430 YFCILFTYESMNWSW 386 YFC+++T S N+SW Sbjct: 748 YFCVVYTGGSSNFSW 762 >SPAC31A2.12 |||arrestin/PY protein 1|Schizosaccharomyces pombe|chr 1|||Manual Length = 596 Score = 25.8 bits (54), Expect = 3.0 Identities = 13/46 (28%), Positives = 19/46 (41%) Frame = -3 Query: 233 RALYHQAMALSGLVXDDESSETRHESSKGAPHNDRVRSSSPTAARV 96 R+ H + SG+ S+ H S P+ PT+ARV Sbjct: 527 RSFEHSTSSSSGISPSHSSASLAHLSQASNPNGSSSAPHRPTSARV 572 >SPAC1002.16c |||nicotinic acid plasma membrane transporter |Schizosaccharomyces pombe|chr 1|||Manual Length = 499 Score = 24.2 bits (50), Expect = 9.3 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = -1 Query: 286 VFPLWGFVL*LTCTSQRSV 230 +FP+ G++L L C + +SV Sbjct: 360 IFPIVGYILLLACQNNKSV 378 >SPBC902.02c |ctf18|chl12|DNA replication factor C complex subunit Ctf18|Schizosaccharomyces pombe|chr 2|||Manual Length = 960 Score = 24.2 bits (50), Expect = 9.3 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = -3 Query: 188 DDESSETRHESSKGAPHNDRVRSSSPTAARV 96 DD ++ T HE A N SS PT V Sbjct: 451 DDRTAHTVHEKVSSAISNHSALSSQPTCVIV 481 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,651,861 Number of Sequences: 5004 Number of extensions: 26495 Number of successful extensions: 73 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 68 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 73 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 164204010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -