BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060777.seq (608 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39508| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 29 3.9 SB_29514| Best HMM Match : MotA_ExbB (HMM E-Value=0.21) 28 6.8 >SB_39508| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 1814 Score = 28.7 bits (61), Expect = 3.9 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +1 Query: 406 KNHQESILESAGTWLKRSLQSVQAVEINSAHLAGIRS 516 KN + + +E G W R++ Q +EIN H+ + S Sbjct: 1010 KNARLNNIEGEGAWCPRTVDQSQFLEINIGHVTRVTS 1046 >SB_29514| Best HMM Match : MotA_ExbB (HMM E-Value=0.21) Length = 368 Score = 27.9 bits (59), Expect = 6.8 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +3 Query: 396 HSIQKSPRVHFRVSWNLAETIFAECPGSRDKLCSFGW 506 H + RV + +W+ + A PGSRDK+ + W Sbjct: 297 HGSYRDWRVAEKTAWSGPSKVLAVIPGSRDKIQNNTW 333 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,037,596 Number of Sequences: 59808 Number of extensions: 357753 Number of successful extensions: 733 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 687 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 733 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1487884875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -