BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060777.seq (608 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY555274-1|AAS66753.1| 2223|Homo sapiens PF6 protein. 30 5.5 AL513191-1|CAH71478.1| 2223|Homo sapiens sperm associated antige... 30 5.5 AL139345-2|CAI22957.1| 2223|Homo sapiens sperm associated antige... 30 5.5 AL139345-1|CAI22956.1| 660|Homo sapiens sperm associated antige... 30 5.5 AL121993-5|CAI22740.1| 2223|Homo sapiens sperm associated antige... 30 5.5 AL121993-1|CAI22736.1| 660|Homo sapiens sperm associated antige... 30 5.5 BC030651-1|AAH30651.1| 621|Homo sapiens AGBL3 protein protein. 29 9.7 >AY555274-1|AAS66753.1| 2223|Homo sapiens PF6 protein. Length = 2223 Score = 30.3 bits (65), Expect = 5.5 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -1 Query: 398 MTFPYLNERESSMVSDFALHLIELMKNHTEKPP 300 M+FP + E S V++ A HL +L K PP Sbjct: 1825 MSFPKMEETTKSHVTEVAAHLTDLFKQSLATPP 1857 >AL513191-1|CAH71478.1| 2223|Homo sapiens sperm associated antigen 17 protein. Length = 2223 Score = 30.3 bits (65), Expect = 5.5 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -1 Query: 398 MTFPYLNERESSMVSDFALHLIELMKNHTEKPP 300 M+FP + E S V++ A HL +L K PP Sbjct: 1825 MSFPKMEETTKSHVTEVAAHLTDLFKQSLATPP 1857 >AL139345-2|CAI22957.1| 2223|Homo sapiens sperm associated antigen 17 protein. Length = 2223 Score = 30.3 bits (65), Expect = 5.5 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -1 Query: 398 MTFPYLNERESSMVSDFALHLIELMKNHTEKPP 300 M+FP + E S V++ A HL +L K PP Sbjct: 1825 MSFPKMEETTKSHVTEVAAHLTDLFKQSLATPP 1857 >AL139345-1|CAI22956.1| 660|Homo sapiens sperm associated antigen 17 protein. Length = 660 Score = 30.3 bits (65), Expect = 5.5 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -1 Query: 398 MTFPYLNERESSMVSDFALHLIELMKNHTEKPP 300 M+FP + E S V++ A HL +L K PP Sbjct: 305 MSFPKMEETTKSHVTEVAAHLTDLFKQSLATPP 337 >AL121993-5|CAI22740.1| 2223|Homo sapiens sperm associated antigen 17 protein. Length = 2223 Score = 30.3 bits (65), Expect = 5.5 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -1 Query: 398 MTFPYLNERESSMVSDFALHLIELMKNHTEKPP 300 M+FP + E S V++ A HL +L K PP Sbjct: 1825 MSFPKMEETTKSHVTEVAAHLTDLFKQSLATPP 1857 >AL121993-1|CAI22736.1| 660|Homo sapiens sperm associated antigen 17 protein. Length = 660 Score = 30.3 bits (65), Expect = 5.5 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -1 Query: 398 MTFPYLNERESSMVSDFALHLIELMKNHTEKPP 300 M+FP + E S V++ A HL +L K PP Sbjct: 305 MSFPKMEETTKSHVTEVAAHLTDLFKQSLATPP 337 >BC030651-1|AAH30651.1| 621|Homo sapiens AGBL3 protein protein. Length = 621 Score = 29.5 bits (63), Expect = 9.7 Identities = 18/50 (36%), Positives = 27/50 (54%) Frame = -3 Query: 249 TDHSITRYVHRALFHCLFTLNFKGSDHFVLCIIKFGSVQKSKEATGTQIV 100 +D S T Y+ + +F + + N F C KF +VQKSKE TG ++ Sbjct: 476 SDRSKTLYLQQRIFPLMLSKNCPDKFSFSAC--KF-NVQKSKEGTGRVVM 522 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 86,218,567 Number of Sequences: 237096 Number of extensions: 1698542 Number of successful extensions: 6668 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 6624 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6668 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6466646650 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -