BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060777.seq (608 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 23 1.8 AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. 21 7.1 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 23.4 bits (48), Expect = 1.8 Identities = 8/17 (47%), Positives = 14/17 (82%) Frame = -2 Query: 58 YLRLVAFHSIILGSVLS 8 ++ + FHSI+LGS+L+ Sbjct: 455 FIEPIYFHSIVLGSLLN 471 >AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. Length = 349 Score = 21.4 bits (43), Expect = 7.1 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = -1 Query: 233 HVTYIGLYSIVYLRSILKDPTILYYVS*NLDQSKS 129 H+ I YS++ + S + + T+L ++ SKS Sbjct: 37 HIVSIVFYSVLMIISAIGNTTVLILITCRKRVSKS 71 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,123 Number of Sequences: 438 Number of extensions: 3243 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17971191 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -