BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060776.seq (630 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 27 0.13 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 22 4.9 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 21 8.5 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 27.1 bits (57), Expect = 0.13 Identities = 20/59 (33%), Positives = 24/59 (40%), Gaps = 1/59 (1%) Frame = -3 Query: 487 CGNGC-GYDCASNYDGGNETWTCACDRNDSCMAMRGDHIAPSEREVPCRPTFVRPSCPG 314 C +G GY C N D + AC N +C+ G E C P FV P C G Sbjct: 248 CPSGTLGYICEINVD---DCRPGACHNNGTCLDKVGGF------ECKCPPGFVGPRCEG 297 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 21.8 bits (44), Expect = 4.9 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 Query: 365 RWRDMVAPHRHTGVV 409 RWRD + H+GVV Sbjct: 310 RWRDRIYDAIHSGVV 324 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 21.0 bits (42), Expect = 8.5 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -3 Query: 514 NFLSQSESDCGNG 476 +F Q+ S CGNG Sbjct: 38 SFRKQNSSSCGNG 50 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 122,083 Number of Sequences: 336 Number of extensions: 2263 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16188355 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -