BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060776.seq (630 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC... 54 6e-08 At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC... 54 6e-08 At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30... 45 4e-05 At3g13570.1 68416.m01707 SC35-like splicing factor, 30a kD (SCL3... 45 5e-05 At1g55310.1 68414.m06318 SC35-like splicing factor, 33 kD (SCL33... 44 1e-04 At3g10400.1 68416.m01246 RNA recognition motif (RRM)-containing ... 42 3e-04 At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR... 42 3e-04 At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR... 42 3e-04 At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR... 42 3e-04 At3g08000.1 68416.m00977 RNA-binding protein, putative similar t... 42 4e-04 At4g20030.1 68417.m02932 RNA recognition motif (RRM)-containing ... 41 6e-04 At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing ... 41 6e-04 At1g13690.1 68414.m01609 RNA recognition motif (RRM)-containing ... 41 6e-04 At5g18810.1 68418.m02235 SC35-like splicing factor, 28 kD (SCL28... 40 0.001 At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR... 40 0.001 At4g02430.1 68417.m00329 pre-mRNA splicing factor, putative / SR... 40 0.001 At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putat... 40 0.002 At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putat... 40 0.002 At3g14100.1 68416.m01782 oligouridylate-binding protein, putativ... 40 0.002 At3g46020.1 68416.m04979 RNA-binding protein, putative similar t... 39 0.002 At3g26420.1 68416.m03295 glycine-rich RNA-binding protein simila... 39 0.003 At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, ... 39 0.003 At1g17370.1 68414.m02118 oligouridylate-binding protein, putativ... 39 0.003 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 38 0.004 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 38 0.004 At1g54080.2 68414.m06163 oligouridylate-binding protein, putativ... 38 0.004 At1g54080.1 68414.m06162 oligouridylate-binding protein, putativ... 38 0.004 At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putat... 38 0.005 At3g49430.1 68416.m05403 pre-mRNA splicing factor, putative stro... 38 0.005 At1g09140.1 68414.m01018 SF2/ASF-like splicing modulator (SRP30)... 38 0.005 At5g19030.1 68418.m02261 RNA recognition motif (RRM)-containing ... 38 0.007 At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, ... 38 0.007 At1g67770.1 68414.m07733 RNA-binding protein, putative similar t... 38 0.007 At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP... 37 0.010 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 37 0.010 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 37 0.010 At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, ... 37 0.010 At2g37340.3 68415.m04580 splicing factor RSZ33 (RSZ33) nearly id... 37 0.010 At2g37340.1 68415.m04581 splicing factor RSZ33 (RSZ33) nearly id... 37 0.010 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 37 0.010 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 37 0.010 At4g03110.1 68417.m00420 RNA-binding protein, putative similar t... 37 0.013 At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, ... 37 0.013 At3g11400.1 68416.m01390 eukaryotic translation initiation facto... 37 0.013 At3g53500.2 68416.m05907 zinc knuckle (CCHC-type) family protein... 36 0.017 At3g53500.1 68416.m05906 zinc knuckle (CCHC-type) family protein... 36 0.017 At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing ... 36 0.017 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 36 0.022 At5g54580.1 68418.m06794 RNA recognition motif (RRM)-containing ... 36 0.022 At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast /... 36 0.022 At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast /... 36 0.022 At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing ... 36 0.029 At1g74230.1 68414.m08597 glycine-rich RNA-binding protein simila... 36 0.029 At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, ... 35 0.039 At5g06000.1 68418.m00665 eukaryotic translation initiation facto... 35 0.039 At3g26120.1 68416.m03257 RNA-binding protein, putative similar t... 35 0.051 At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putat... 35 0.051 At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonu... 35 0.051 At1g03457.2 68414.m00327 RNA-binding protein, putative similar t... 35 0.051 At1g03457.1 68414.m00326 RNA-binding protein, putative similar t... 35 0.051 At5g59860.1 68418.m07506 RNA recognition motif (RRM)-containing ... 34 0.068 At3g50670.1 68416.m05542 U1 small nuclear ribonucleoprotein 70 (... 34 0.068 At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putat... 34 0.068 At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putat... 34 0.068 At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondria... 34 0.089 At5g06210.1 68418.m00693 RNA-binding protein, putative contains ... 34 0.089 At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing ... 34 0.089 At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing ... 34 0.089 At2g47310.1 68415.m05906 flowering time control protein-related ... 34 0.089 At1g49760.1 68414.m05580 polyadenylate-binding protein, putative... 34 0.089 At5g03580.1 68418.m00316 polyadenylate-binding protein, putative... 33 0.12 At5g51120.1 68418.m06339 polyadenylate-binding protein, putative... 33 0.16 At3g55340.1 68416.m06146 RNA recognition motif (RRM)-containing ... 33 0.16 At3g54230.1 68416.m05994 zinc finger protein-related / D111/G-pa... 33 0.16 At3g19130.1 68416.m02429 RNA-binding protein, putative similar t... 33 0.16 At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing ... 33 0.16 At5g16260.1 68418.m01899 RNA recognition motif (RRM)-containing ... 33 0.21 At5g07290.1 68418.m00832 RNA recognition motif (RRM)-containing ... 33 0.21 At2g35410.1 68415.m04340 33 kDa ribonucleoprotein, chloroplast, ... 33 0.21 At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putativ... 33 0.21 At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative 32 0.27 At5g04280.1 68418.m00421 glycine-rich RNA-binding protein 32 0.27 At4g12640.1 68417.m01989 RNA recognition motif (RRM)-containing ... 32 0.27 At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) 32 0.27 At2g36660.1 68415.m04496 polyadenylate-binding protein, putative... 32 0.36 At2g27330.1 68415.m03286 RNA recognition motif (RRM)-containing ... 32 0.36 At5g65260.1 68418.m08209 polyadenylate-binding protein family pr... 31 0.48 At5g10350.2 68418.m01201 polyadenylate-binding protein family pr... 31 0.48 At5g10350.1 68418.m01200 polyadenylate-binding protein family pr... 31 0.48 At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2)... 31 0.48 At2g37510.1 68415.m04600 RNA-binding protein, putative similar t... 31 0.48 At2g23350.1 68415.m02788 polyadenylate-binding protein, putative... 31 0.48 At1g16610.2 68414.m01990 arginine/serine-rich protein, putative ... 31 0.48 At1g16610.1 68414.m01989 arginine/serine-rich protein, putative ... 31 0.48 At1g07350.2 68414.m00784 transformer serine/arginine-rich ribonu... 31 0.48 At5g51300.2 68418.m06360 splicing factor-related contains simila... 31 0.63 At5g51300.1 68418.m06359 splicing factor-related contains simila... 31 0.63 At4g35785.2 68417.m05083 transformer serine/arginine-rich ribonu... 31 0.63 At4g35785.1 68417.m05082 transformer serine/arginine-rich ribonu... 31 0.63 At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing ... 31 0.63 At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing ... 31 0.63 At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing ... 31 0.63 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 31 0.83 At4g09040.1 68417.m01491 RNA recognition motif (RRM)-containing ... 31 0.83 At4g16280.3 68417.m02471 flowering time control protein / FCA ga... 30 1.1 At4g16280.2 68417.m02470 flowering time control protein / FCA ga... 30 1.1 At3g20930.1 68416.m02645 RNA recognition motif (RRM)-containing ... 30 1.1 At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profi... 30 1.1 At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5)... 30 1.1 At1g34140.1 68414.m04235 polyadenylate-binding protein, putative... 30 1.1 At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putat... 30 1.1 At5g52040.2 68418.m06459 arginine/serine-rich splicing factor RS... 30 1.5 At5g52040.1 68418.m06458 arginine/serine-rich splicing factor RS... 30 1.5 At5g03480.1 68418.m00304 expressed protein ; expression support... 30 1.5 At4g25500.1 68417.m03673 arginine/serine-rich splicing factor RS... 30 1.5 At3g16380.1 68416.m02074 polyadenylate-binding protein, putative... 30 1.5 At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative simi... 30 1.5 At1g01080.1 68414.m00010 33 kDa ribonucleoprotein, chloroplast, ... 30 1.5 At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-l... 29 1.9 At2g46610.2 68415.m05813 arginine/serine-rich splicing factor, p... 29 1.9 At2g46610.1 68415.m05814 arginine/serine-rich splicing factor, p... 29 1.9 At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing ... 29 1.9 At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putativ... 29 2.5 At3g09160.1 68416.m01082 RNA recognition motif (RRM)-containing ... 29 2.5 At2g37340.2 68415.m04579 splicing factor RSZ33 (RSZ33) nearly id... 29 2.5 At2g24590.1 68415.m02936 splicing factor, putative similar to to... 29 2.5 At5g19030.2 68418.m02262 RNA recognition motif (RRM)-containing ... 29 3.4 At1g51510.1 68414.m05797 RNA-binding protein, putative similar t... 29 3.4 At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putativ... 29 3.4 At1g47490.2 68414.m05269 RNA-binding protein 47 (RBP47), putativ... 29 3.4 At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putativ... 29 3.4 At3g61860.1 68416.m06947 arginine/serine-rich splicing factor RS... 28 4.4 At3g56430.1 68416.m06276 expressed protein unknown protein At2g4... 28 4.4 At3g53830.1 68416.m05947 regulator of chromosome condensation (R... 28 4.4 At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing ... 28 4.4 At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nea... 28 4.4 At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nea... 28 4.4 At1g47620.1 68414.m05289 cytochrome P450, putative similar to cy... 28 4.4 At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putativ... 28 5.9 At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing ... 28 5.9 At3g52660.1 68416.m05801 RNA recognition motif (RRM)-containing ... 28 5.9 At1g75820.1 68414.m08807 CLAVATA1 receptor kinase (CLV1) identic... 28 5.9 At1g07600.1 68414.m00813 metallothionein-like protein 1A (MT-1A)... 28 5.9 At5g40510.1 68418.m04914 expressed protein 27 7.8 At5g03500.1 68418.m00306 transcriptional co-activator-related lo... 27 7.8 At4g19670.1 68417.m02889 zinc finger (C3HC4-type RING finger) fa... 27 7.8 At2g40800.1 68415.m05033 expressed protein 27 7.8 At1g23860.2 68414.m03010 splicing factor RSZp21 (RSZP21) / 9G8-l... 27 7.8 At1g23860.1 68414.m03009 splicing factor RSZp21 (RSZP21) / 9G8-l... 27 7.8 >At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 54.4 bits (125), Expect = 6e-08 Identities = 22/41 (53%), Positives = 34/41 (82%) Frame = +1 Query: 259 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMARYG 381 +SRGFAFVR+ + +A +A++ +DGR++DGRE+ VQ A+YG Sbjct: 55 DSRGFAFVRYKYKDEAHKAVERLDGRVVDGREITVQFAKYG 95 Score = 50.4 bits (115), Expect = 1e-06 Identities = 25/51 (49%), Positives = 34/51 (66%), Gaps = 1/51 (1%) Frame = +2 Query: 110 YGRP-PPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYKG 259 +GR PP I SL V N+T+RTT +DL +F + G+V D++IPRDR G Sbjct: 4 FGRSGPPDISDTYSLLVLNITFRTTADDLYPLFAKYGKVVDVFIPRDRRTG 54 >At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 54.4 bits (125), Expect = 6e-08 Identities = 22/41 (53%), Positives = 34/41 (82%) Frame = +1 Query: 259 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMARYG 381 +SRGFAFVR+ + +A +A++ +DGR++DGRE+ VQ A+YG Sbjct: 55 DSRGFAFVRYKYKDEAHKAVERLDGRVVDGREITVQFAKYG 95 Score = 50.4 bits (115), Expect = 1e-06 Identities = 25/51 (49%), Positives = 34/51 (66%), Gaps = 1/51 (1%) Frame = +2 Query: 110 YGRP-PPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYKG 259 +GR PP I SL V N+T+RTT +DL +F + G+V D++IPRDR G Sbjct: 4 FGRSGPPDISDTYSLLVLNITFRTTADDLYPLFAKYGKVVDVFIPRDRRTG 54 >At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30) nearly identical to SC35-like splicing factor SCL30, 30 kD [Arabidopsis thaliana] GI:9843657; Serine/arginine-rich protein/putative splicing factor, Arabidopdis thaliana, EMBL:AF099940; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 262 Score = 45.2 bits (102), Expect = 4e-05 Identities = 21/39 (53%), Positives = 25/39 (64%) Frame = +2 Query: 146 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYKGK 262 SL V N+ PE+LR FER G V D+YIPRD Y G+ Sbjct: 48 SLLVRNIPLDCRPEELREPFERFGPVRDVYIPRDYYSGQ 86 Score = 36.3 bits (80), Expect = 0.017 Identities = 18/38 (47%), Positives = 24/38 (63%) Frame = +1 Query: 259 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 372 + RGFAFV F + DA EA +M+ R GRE+ V +A Sbjct: 86 QPRGFAFVEFVDAYDAGEAQRSMNRRSFAGREITVVVA 123 >At3g13570.1 68416.m01707 SC35-like splicing factor, 30a kD (SCL30a) almost identical to SC35-like splicing factor SCL30a GI:9843661 from [Arabidopsis thaliana]; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 262 Score = 44.8 bits (101), Expect = 5e-05 Identities = 22/38 (57%), Positives = 25/38 (65%) Frame = +2 Query: 146 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYKG 259 SL V NL + EDLRR FE+ G V DIY+PRD Y G Sbjct: 38 SLLVRNLRHDCRQEDLRRPFEQFGPVKDIYLPRDYYTG 75 Score = 39.9 bits (89), Expect = 0.001 Identities = 19/38 (50%), Positives = 24/38 (63%) Frame = +1 Query: 259 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 372 + RGF F++F + DA EA MDG +L GREL V A Sbjct: 76 DPRGFGFIQFMDPADAAEAKHQMDGYLLLGRELTVVFA 113 >At1g55310.1 68414.m06318 SC35-like splicing factor, 33 kD (SCL33) nearly identical to SC35-like splicing factor SCL33, 33 kD [Arabidopsis thaliana] GI:9843659 Length = 220 Score = 43.6 bits (98), Expect = 1e-04 Identities = 21/38 (55%), Positives = 25/38 (65%) Frame = +2 Query: 146 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYKG 259 SL V NL + EDLR+ FE+ G V DIY+PRD Y G Sbjct: 37 SLLVRNLRHDCRQEDLRKSFEQFGPVKDIYLPRDYYTG 74 Score = 38.7 bits (86), Expect = 0.003 Identities = 19/38 (50%), Positives = 24/38 (63%) Frame = +1 Query: 259 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 372 + RGF FV+F + DA +A MDG +L GREL V A Sbjct: 75 DPRGFGFVQFMDPADAADAKHHMDGYLLLGRELTVVFA 112 >At3g10400.1 68416.m01246 RNA recognition motif (RRM)-containing protein low similarity to splicing factor SC35 [Arabidopsis thaliana] GI:9843653; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 261 Score = 42.3 bits (95), Expect = 3e-04 Identities = 19/39 (48%), Positives = 28/39 (71%) Frame = +1 Query: 256 RESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 372 R+SRG AFV + R DA +A +MD ++L+GR+L V +A Sbjct: 95 RQSRGVAFVLYVSREDAAKAARSMDAKILNGRKLTVSIA 133 >At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 41.9 bits (94), Expect = 3e-04 Identities = 19/38 (50%), Positives = 25/38 (65%) Frame = +1 Query: 268 GFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMARYG 381 G+AFV F + RDAE+A+ DG DG LRV++A G Sbjct: 46 GYAFVEFDDARDAEDAIHGRDGYDFDGHRLRVELAHGG 83 >At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 285 Score = 41.9 bits (94), Expect = 3e-04 Identities = 19/38 (50%), Positives = 25/38 (65%) Frame = +1 Query: 268 GFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMARYG 381 G+AFV F + RDAE+A+ DG DG LRV++A G Sbjct: 46 GYAFVEFDDARDAEDAIHGRDGYDFDGHRLRVELAHGG 83 >At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 41.9 bits (94), Expect = 3e-04 Identities = 19/38 (50%), Positives = 25/38 (65%) Frame = +1 Query: 268 GFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMARYG 381 G+AFV F + RDAE+A+ DG DG LRV++A G Sbjct: 46 GYAFVEFDDARDAEDAIHGRDGYDFDGHRLRVELAHGG 83 >At3g08000.1 68416.m00977 RNA-binding protein, putative similar to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 143 Score = 41.5 bits (93), Expect = 4e-04 Identities = 21/37 (56%), Positives = 23/37 (62%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 372 SRGF FV F E DA A D MDG+ L GR LR+ A Sbjct: 81 SRGFGFVDFAEEGDALSAKDAMDGKGLLGRPLRISFA 117 >At4g20030.1 68417.m02932 RNA recognition motif (RRM)-containing protein low similarity to heterogeneous nuclear ribonucleoprotein G [Mus musculus] GI:5579009; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 152 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/42 (40%), Positives = 30/42 (71%) Frame = +1 Query: 256 RESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMARYG 381 + S+G+AF++F + DA A++TMD RM +GR + + +A+ G Sbjct: 78 KRSKGYAFIQFTSQDDAFLAIETMDRRMYNGRMIYIDIAKPG 119 >At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 272 Score = 41.1 bits (92), Expect = 6e-04 Identities = 18/36 (50%), Positives = 25/36 (69%) Frame = +2 Query: 155 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYKGK 262 V NLT+RTT +DLRR FE+ G+V D + + Y G+ Sbjct: 16 VGNLTWRTTADDLRRYFEQFGQVVDANVVSETYPGR 51 >At1g13690.1 68414.m01609 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif Length = 177 Score = 41.1 bits (92), Expect = 6e-04 Identities = 20/39 (51%), Positives = 23/39 (58%) Frame = +1 Query: 256 RESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 372 ++ R F FV F ER DA A+D MDG L GR L V A Sbjct: 51 QKHRSFGFVTFLEREDASAAMDNMDGAELYGRVLTVNYA 89 >At5g18810.1 68418.m02235 SC35-like splicing factor, 28 kD (SCL28) nearly identical to SC35-like splicing factor SCL28, 28 kD [Arabidopsis thaliana] GI:9843655; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 236 Score = 39.9 bits (89), Expect = 0.001 Identities = 19/42 (45%), Positives = 24/42 (57%) Frame = +2 Query: 137 GMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYKGK 262 G L + NL P DLR FER G + DIY+PR+ Y G+ Sbjct: 45 GPSGLLIRNLPLDARPNDLRDSFERFGPLKDIYLPRNYYTGE 86 Score = 35.5 bits (78), Expect = 0.029 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = +1 Query: 259 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 372 E RGF FV++ DA EA+ M+ +++ GRE+ + A Sbjct: 86 EPRGFGFVKYRYAEDAAEAMKRMNHKVIGGREIAIVFA 123 >At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR1 protein, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana}; cDNA NCBI_gi:15810292 supports a truncated version while protein evidence supports a longer model. Length = 278 Score = 39.9 bits (89), Expect = 0.001 Identities = 18/38 (47%), Positives = 25/38 (65%) Frame = +1 Query: 268 GFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMARYG 381 G+AFV F + RDA++A+ DG DG LRV++A G Sbjct: 46 GYAFVEFEDARDADDAIYGRDGYDFDGHHLRVELAHGG 83 >At4g02430.1 68417.m00329 pre-mRNA splicing factor, putative / SR1 protein, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana}; cDNA NCBI_gi:15810292 supports a truncated version while protein evidence supports a longer model. Length = 178 Score = 39.9 bits (89), Expect = 0.001 Identities = 18/38 (47%), Positives = 25/38 (65%) Frame = +1 Query: 268 GFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMARYG 381 G+AFV F + RDA++A+ DG DG LRV++A G Sbjct: 46 GYAFVEFEDARDADDAIYGRDGYDFDGHHLRVELAHGG 83 >At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/37 (48%), Positives = 24/37 (64%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 372 SRGF FV F A A+ MDG+ L+GR++RV +A Sbjct: 75 SRGFGFVSFSCEDSANNAIKEMDGKELNGRQIRVNLA 111 >At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/37 (48%), Positives = 24/37 (64%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 372 SRGF FV F A A+ MDG+ L+GR++RV +A Sbjct: 75 SRGFGFVSFSCEDSANNAIKEMDGKELNGRQIRVNLA 111 >At3g14100.1 68416.m01782 oligouridylate-binding protein, putative similar to GB:CAB75429 (GI:6996560) from [Nicotiana plumbaginifolia], contains Pfam profiles: PF00076 RNA recognition motif (3 copies) Length = 427 Score = 39.5 bits (88), Expect = 0.002 Identities = 17/40 (42%), Positives = 26/40 (65%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMARYG 381 SRGF FV F ++DA+ A++ M+G+ L R++R A G Sbjct: 184 SRGFGFVSFRNQQDAQTAINEMNGKWLSSRQIRCNWATKG 223 Score = 36.3 bits (80), Expect = 0.017 Identities = 16/59 (27%), Positives = 35/59 (59%) Frame = +1 Query: 196 PRFRKVRRSW*YLHSQRSVQRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 372 P +++ S + S + ++++ + FV +F+RR A A+ +++GR L G+ ++V A Sbjct: 73 PLLQEIFTSTGPVESSKLIRKDKSSYGFVHYFDRRSAALAILSLNGRHLFGQPIKVNWA 131 >At3g46020.1 68416.m04979 RNA-binding protein, putative similar to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis}; SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 102 Score = 39.1 bits (87), Expect = 0.002 Identities = 16/43 (37%), Positives = 29/43 (67%) Frame = +1 Query: 247 SVQRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 375 S + +GF F+ F DA +AL ++DG+++DGR + V++A+ Sbjct: 42 SETQRPKGFGFITFDSEDDARKALKSLDGKIVDGRLIFVEVAK 84 >At3g26420.1 68416.m03295 glycine-rich RNA-binding protein similar to RNA-binding protein (RZ-1) GB:BAA12064 [Nicotiana sylvestris]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 245 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/38 (44%), Positives = 25/38 (65%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 375 SRGF F+ F E++ +EA+ M+G LDGR + V A+ Sbjct: 47 SRGFGFITFDEKKAMDEAIAAMNGMDLDGRTITVDKAQ 84 >At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to 29 kDa ribonucleoprotein chloroplast precursor {Nicotiana sylvestris} SP|Q08935, SP|Q08937; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) contains an AG-donor site at intron. Length = 258 Score = 38.7 bits (86), Expect = 0.003 Identities = 16/38 (42%), Positives = 27/38 (71%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 375 SRG+ FV + + + E AL+++DG L+GR +RV +A+ Sbjct: 217 SRGYGFVCYSSKAEMETALESLDGFELEGRAIRVNLAQ 254 Score = 32.7 bits (71), Expect = 0.21 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = +1 Query: 259 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 372 +SRGFAFV D +D +DG GR L+V A Sbjct: 124 QSRGFAFVTMSNVEDCNIIIDNLDGTEYLGRALKVNFA 161 >At1g17370.1 68414.m02118 oligouridylate-binding protein, putative similar to oligouridylate binding protein [Nicotiana plumbaginifolia] GI:6996560; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 419 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/40 (42%), Positives = 25/40 (62%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMARYG 381 SRGF FV F ++DA+ A+D + G+ L R++R A G Sbjct: 179 SRGFGFVSFRNQQDAQTAIDEITGKWLGSRQIRCNWATKG 218 Score = 35.5 bits (78), Expect = 0.029 Identities = 15/47 (31%), Positives = 30/47 (63%) Frame = +1 Query: 232 LHSQRSVQRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 372 + S + +++E + FV +F+RR A A+ +++GR L G+ ++V A Sbjct: 80 VESCKLIRKEKSSYGFVHYFDRRSAGLAILSLNGRHLFGQPIKVNWA 126 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 38.3 bits (85), Expect = 0.004 Identities = 18/37 (48%), Positives = 23/37 (62%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 372 SRGF FV F + A A+ MDG+ L+GR +RV A Sbjct: 75 SRGFGFVNFNDEGAATAAISEMDGKELNGRHIRVNPA 111 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 38.3 bits (85), Expect = 0.004 Identities = 18/37 (48%), Positives = 23/37 (62%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 372 SRGF FV F + A A+ MDG+ L+GR +RV A Sbjct: 75 SRGFGFVNFNDEGAATAAISEMDGKELNGRHIRVNPA 111 >At1g54080.2 68414.m06163 oligouridylate-binding protein, putative similar to oligouridylate binding protein GI:6996560 from [Nicotiana plumbaginifolia] Length = 430 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/40 (40%), Positives = 26/40 (65%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMARYG 381 SRGF FV F ++DA+ A++ M+G+ + R++R A G Sbjct: 192 SRGFGFVSFRNQQDAQTAINEMNGKWVSSRQIRCNWATKG 231 Score = 35.9 bits (79), Expect = 0.022 Identities = 14/47 (29%), Positives = 30/47 (63%) Frame = +1 Query: 232 LHSQRSVQRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 372 + S + ++++ + FV +F+RR A A+ T++GR + G+ ++V A Sbjct: 89 IESCKLIRKDKSSYGFVHYFDRRCASMAIMTLNGRHIFGQPMKVNWA 135 >At1g54080.1 68414.m06162 oligouridylate-binding protein, putative similar to oligouridylate binding protein GI:6996560 from [Nicotiana plumbaginifolia] Length = 426 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/40 (40%), Positives = 26/40 (65%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMARYG 381 SRGF FV F ++DA+ A++ M+G+ + R++R A G Sbjct: 188 SRGFGFVSFRNQQDAQTAINEMNGKWVSSRQIRCNWATKG 227 Score = 35.9 bits (79), Expect = 0.022 Identities = 14/47 (29%), Positives = 30/47 (63%) Frame = +1 Query: 232 LHSQRSVQRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 372 + S + ++++ + FV +F+RR A A+ T++GR + G+ ++V A Sbjct: 89 IESCKLIRKDKSSYGFVHYFDRRCASMAIMTLNGRHIFGQPMKVNWA 135 >At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana] ; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 87 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/40 (42%), Positives = 25/40 (62%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMARYG 381 SRGF FV + +AE A+ MDG+ L+GR + V++ G Sbjct: 43 SRGFGFVTYSSHSEAEAAVSGMDGKELNGRRVSVKLFGIG 82 >At3g49430.1 68416.m05403 pre-mRNA splicing factor, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 300 Score = 37.9 bits (84), Expect = 0.005 Identities = 18/37 (48%), Positives = 23/37 (62%) Frame = +1 Query: 271 FAFVRFFERRDAEEALDTMDGRMLDGRELRVQMARYG 381 + FV F RDAE+A+ DG LDG LRV++A G Sbjct: 47 YCFVEFEHSRDAEDAIKGRDGYNLDGCRLRVELAHGG 83 >At1g09140.1 68414.m01018 SF2/ASF-like splicing modulator (SRP30) nearly identical to SF2/ASF-like splicing modulator Srp30 [Arabidopsis thaliana] GI:4775270 Length = 268 Score = 37.9 bits (84), Expect = 0.005 Identities = 18/38 (47%), Positives = 25/38 (65%) Frame = +1 Query: 268 GFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMARYG 381 G+AFV F + RDA++A+ DG DG LRV++A G Sbjct: 46 GYAFVEFEDPRDADDAIYGRDGYDFDGCRLRVEIAHGG 83 >At5g19030.1 68418.m02261 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 172 Score = 37.5 bits (83), Expect = 0.007 Identities = 15/42 (35%), Positives = 27/42 (64%) Frame = +1 Query: 256 RESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMARYG 381 R+S G+ +V F + DA+ A++ M+G+ DGR + V+ + G Sbjct: 115 RQSLGYGYVWFNSKEDAQSAVEAMNGKFFDGRFILVKFGQPG 156 >At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 289 Score = 37.5 bits (83), Expect = 0.007 Identities = 15/37 (40%), Positives = 25/37 (67%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 372 S+GF FV + ++ + A+ ++DG LDGR++RV A Sbjct: 244 SKGFGFVTYDSSQEVQNAIKSLDGADLDGRQIRVSEA 280 Score = 31.5 bits (68), Expect = 0.48 Identities = 16/34 (47%), Positives = 18/34 (52%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 363 SRGF FV + E A +G LDGR LRV Sbjct: 131 SRGFGFVTMSSVSEVEAAAQQFNGYELDGRPLRV 164 >At1g67770.1 68414.m07733 RNA-binding protein, putative similar to terminal ear1 gb|AAC39463.1 Length = 527 Score = 37.5 bits (83), Expect = 0.007 Identities = 18/43 (41%), Positives = 29/43 (67%) Frame = +1 Query: 253 QRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMARYG 381 +RE R FV FF+ RDA +AL M+G+++ G+ + +Q +R G Sbjct: 218 KREQR---FVEFFDVRDAAKALRVMNGKVISGKPMVIQFSRPG 257 >At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 92 Score = 37.1 bits (82), Expect = 0.010 Identities = 16/38 (42%), Positives = 25/38 (65%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 375 SRGF FV F + + +A++ M+G+ LDGR + V A+ Sbjct: 46 SRGFGFVTFKDEKAMRDAIEEMNGKELDGRVITVNEAQ 83 Score = 30.7 bits (66), Expect = 0.83 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +2 Query: 155 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYKGK 262 V L + T EDL+R F + G+V D I DR G+ Sbjct: 10 VGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGR 45 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 37.1 bits (82), Expect = 0.010 Identities = 16/38 (42%), Positives = 25/38 (65%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 375 SRGF FV F + + +A++ M+G+ LDGR + V A+ Sbjct: 46 SRGFGFVTFKDEKAMRDAIEEMNGKELDGRVITVNEAQ 83 Score = 30.7 bits (66), Expect = 0.83 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +2 Query: 155 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYKGK 262 V L + T EDL+R F + G+V D I DR G+ Sbjct: 10 VGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGR 45 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 37.1 bits (82), Expect = 0.010 Identities = 16/38 (42%), Positives = 25/38 (65%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 375 SRGF FV F + + +A++ M+G+ LDGR + V A+ Sbjct: 46 SRGFGFVTFKDEKAMRDAIEEMNGKELDGRVITVNEAQ 83 Score = 30.7 bits (66), Expect = 0.83 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +2 Query: 155 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYKGK 262 V L + T EDL+R F + G+V D I DR G+ Sbjct: 10 VGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGR 45 >At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (RNA-binding protein 1/2/3) (AtRBP33) (RNA-binding protein cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 37.1 bits (82), Expect = 0.010 Identities = 16/37 (43%), Positives = 24/37 (64%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 372 SRGF FV + + EA+ +DG+ L+GR +RV +A Sbjct: 284 SRGFGFVTMSDVDELNEAISALDGQNLEGRAIRVNVA 320 Score = 27.5 bits (58), Expect = 7.8 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +1 Query: 259 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 372 +SRGF FV +AE A++ + L+GR L V A Sbjct: 189 QSRGFGFVTMSSVDEAETAVEKFNRYDLNGRLLTVNKA 226 >At2g37340.3 68415.m04580 splicing factor RSZ33 (RSZ33) nearly identical to splicing factor RSZ33 [Arabidopsis thaliana] GI:9843663; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00098: Zinc knuckle Length = 249 Score = 37.1 bits (82), Expect = 0.010 Identities = 16/37 (43%), Positives = 24/37 (64%) Frame = +1 Query: 265 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 375 R +AFV F + RDA++A +DGR DG + V+ +R Sbjct: 3 RDYAFVEFGDPRDADDARHYLDGRDFDGSRITVEFSR 39 >At2g37340.1 68415.m04581 splicing factor RSZ33 (RSZ33) nearly identical to splicing factor RSZ33 [Arabidopsis thaliana] GI:9843663; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00098: Zinc knuckle Length = 290 Score = 37.1 bits (82), Expect = 0.010 Identities = 16/37 (43%), Positives = 24/37 (64%) Frame = +1 Query: 265 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 375 R +AFV F + RDA++A +DGR DG + V+ +R Sbjct: 44 RDYAFVEFGDPRDADDARHYLDGRDFDGSRITVEFSR 80 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 37.1 bits (82), Expect = 0.010 Identities = 16/38 (42%), Positives = 26/38 (68%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 375 SRGF FV F + + ++A++ M+G+ LDGR + V A+ Sbjct: 48 SRGFGFVTFKDEKAMKDAIEGMNGQDLDGRSITVNEAQ 85 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 37.1 bits (82), Expect = 0.010 Identities = 16/38 (42%), Positives = 26/38 (68%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 375 SRGF FV F + + ++A++ M+G+ LDGR + V A+ Sbjct: 48 SRGFGFVTFKDEKAMKDAIEGMNGQDLDGRSITVNEAQ 85 >At4g03110.1 68417.m00420 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 441 Score = 36.7 bits (81), Expect = 0.013 Identities = 16/38 (42%), Positives = 26/38 (68%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 375 S+ F FV + + A+ A+D M+GR L G++L+VQ+ R Sbjct: 389 SKCFGFVSYDSQAAAQNAIDMMNGRHLGGKKLKVQLKR 426 >At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to chloroplast RNA-binding protein (cp33) GB:BAA06523 (Arabidopsis thaliana) (Plant Mol. Biol. 27 (3), 529-539 (1995)); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 36.7 bits (81), Expect = 0.013 Identities = 16/37 (43%), Positives = 24/37 (64%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 372 SRGF F+ F + + AL TM+G ++GR LR+ +A Sbjct: 259 SRGFGFISFESAENVQSALATMNGVEVEGRALRLNLA 295 Score = 28.3 bits (60), Expect = 4.4 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +1 Query: 250 VQRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 363 V SRGF FV +A+EA+ + + GR ++V Sbjct: 152 VTDRSRGFGFVTMGSIEEAKEAMQMFNSSQIGGRTVKV 189 >At3g11400.1 68416.m01390 eukaryotic translation initiation factor 3G / eIF3g nearly identical to eukaryotic translation initiation factor 3g [Arabidopsis thaliana] GI:12407751 Length = 294 Score = 36.7 bits (81), Expect = 0.013 Identities = 17/37 (45%), Positives = 23/37 (62%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 372 SRGF FV F R DA+ A++ ++G D LRV+ A Sbjct: 253 SRGFGFVNFVSREDAQRAINKLNGYGYDNLILRVEWA 289 >At3g53500.2 68416.m05907 zinc knuckle (CCHC-type) family protein contains Pfam domain PF00098: Zinc knuckle Length = 284 Score = 36.3 bits (80), Expect = 0.017 Identities = 16/37 (43%), Positives = 24/37 (64%) Frame = +1 Query: 265 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 375 R +AFV F + RDA++A +DGR DG + V+ +R Sbjct: 44 RDYAFVEFSDPRDADDARYYLDGRDFDGSRITVEASR 80 >At3g53500.1 68416.m05906 zinc knuckle (CCHC-type) family protein contains Pfam domain PF00098: Zinc knuckle Length = 243 Score = 36.3 bits (80), Expect = 0.017 Identities = 16/37 (43%), Positives = 24/37 (64%) Frame = +1 Query: 265 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 375 R +AFV F + RDA++A +DGR DG + V+ +R Sbjct: 3 RDYAFVEFSDPRDADDARYYLDGRDFDGSRITVEASR 39 >At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing protein low similarity to SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 181 Score = 36.3 bits (80), Expect = 0.017 Identities = 16/42 (38%), Positives = 26/42 (61%) Frame = +1 Query: 250 VQRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 375 V +GFAF+R+ +A +A+ M G+ LDGR + V+ A+ Sbjct: 113 VANRPKGFAFLRYETEEEAMKAIQGMHGKFLDGRVIFVEEAK 154 Score = 27.9 bits (59), Expect = 5.9 Identities = 17/46 (36%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +2 Query: 89 SILFKMSYGRPPPRIDG-MVSLKVDNLTYRTTPEDLRRVFERCGEV 223 S L S PP G L V L++RTT + LR FE+ G + Sbjct: 58 SCLSTDSSSSPPSSSSGPKTKLYVSGLSFRTTEDTLRDTFEQFGNL 103 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 35.9 bits (79), Expect = 0.022 Identities = 17/37 (45%), Positives = 21/37 (56%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 372 SRGF FV F A A+ +DGR L GR ++V A Sbjct: 80 SRGFGFVTFTSSEAASSAIQALDGRDLHGRVVKVNYA 116 >At5g54580.1 68418.m06794 RNA recognition motif (RRM)-containing protein low similarity to RNA-binding protein RGP-3 [Nicotiana sylvestris] GI:1009363; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 156 Score = 35.9 bits (79), Expect = 0.022 Identities = 18/45 (40%), Positives = 24/45 (53%) Frame = +2 Query: 125 PRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYKG 259 P+ + +L V L+ RTT E LR F + GEV D + DR G Sbjct: 50 PQAEPSTNLFVSGLSKRTTSEGLRTAFAQFGEVADAKVVTDRVSG 94 Score = 34.3 bits (75), Expect = 0.068 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 375 S+GF FVR+ D+ + + MDG+ LDG + + AR Sbjct: 96 SKGFGFVRYATLEDSAKGIAGMDGKFLDGWVIFAEYAR 133 >At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 334 Score = 35.9 bits (79), Expect = 0.022 Identities = 14/37 (37%), Positives = 26/37 (70%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 372 S+GF FV ++ ++A+++++G LDGR++RV A Sbjct: 289 SKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRVSEA 325 Score = 29.1 bits (62), Expect = 2.5 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = +1 Query: 250 VQRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 363 V SRGF FV + E A +G +GR LRV Sbjct: 135 VTGRSRGFGFVTMSTAAEVEAAAQQFNGYEFEGRPLRV 172 >At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 342 Score = 35.9 bits (79), Expect = 0.022 Identities = 14/37 (37%), Positives = 26/37 (70%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 372 S+GF FV ++ ++A+++++G LDGR++RV A Sbjct: 297 SKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRVSEA 333 Score = 29.1 bits (62), Expect = 2.5 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = +1 Query: 250 VQRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 363 V SRGF FV + E A +G +GR LRV Sbjct: 135 VTGRSRGFGFVTMSTAAEVEAAAQQFNGYEFEGRPLRV 172 >At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 1003 Score = 35.5 bits (78), Expect = 0.029 Identities = 15/40 (37%), Positives = 24/40 (60%) Frame = +1 Query: 259 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMARY 378 E RGFAFV+F + D A++ +G + GR + V+ A + Sbjct: 59 EHRGFAFVKFALQEDVNRAIELKNGSTVGGRRITVKQAAH 98 Score = 31.5 bits (68), Expect = 0.48 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +1 Query: 265 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 372 +GFAFV+F ++DA A+ +G M R + V A Sbjct: 372 KGFAFVKFTCKKDAANAIKKFNGHMFGKRPIAVDWA 407 Score = 31.1 bits (67), Expect = 0.63 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +2 Query: 149 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRD 247 L + NL ++ P D++ VF G V D++IP++ Sbjct: 333 LIIRNLPFQAKPSDIKVVFSAVGFVWDVFIPKN 365 >At1g74230.1 68414.m08597 glycine-rich RNA-binding protein similar to RNA-binding protein GB:S46286 from [Nicotiana sylvestris] Length = 289 Score = 35.5 bits (78), Expect = 0.029 Identities = 18/37 (48%), Positives = 23/37 (62%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 372 SRGFAFV F +A A+ +DG+ L GR +RV A Sbjct: 74 SRGFAFVTFTSTEEASNAMQ-LDGQDLHGRRIRVNYA 109 >At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (1/2/3) (AtRBP33) (cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 289 Score = 35.1 bits (77), Expect = 0.039 Identities = 17/45 (37%), Positives = 26/45 (57%) Frame = +1 Query: 238 SQRSVQRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 372 S R R SRGF FV+ + A+ +DG+ L+GR ++V +A Sbjct: 240 SDRETGR-SRGFGFVQMSNENEVNVAIAALDGQNLEGRAIKVNVA 283 Score = 29.5 bits (63), Expect = 1.9 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +1 Query: 259 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 372 +SRGF FV +AE+A++ + ++GR L V A Sbjct: 152 QSRGFGFVTMSTVEEAEKAVEKFNSFEVNGRRLTVNRA 189 >At5g06000.1 68418.m00665 eukaryotic translation initiation factor 3G, putative / eIF3g, putative similar to eukaryotic translation initiation factor 3g [Arabidopsis thaliana] GI:12407751; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 276 Score = 35.1 bits (77), Expect = 0.039 Identities = 16/35 (45%), Positives = 22/35 (62%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 366 SRGF FV F R DA+ A++ ++G D LRV+ Sbjct: 214 SRGFGFVSFVSREDAQRAINKLNGYGYDNLILRVE 248 >At3g26120.1 68416.m03257 RNA-binding protein, putative similar to GB:AAC39463 from [Zea mays], PF00076 RNA recognition motif (2 copies) Length = 615 Score = 34.7 bits (76), Expect = 0.051 Identities = 13/35 (37%), Positives = 24/35 (68%) Frame = +1 Query: 277 FVRFFERRDAEEALDTMDGRMLDGRELRVQMARYG 381 FV F++ RDA A D M+G+ + G+++ ++ +R G Sbjct: 253 FVEFYDVRDAARAFDRMNGKEIGGKQVVIEFSRPG 287 >At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein from {Daucus carota} SP|Q03878, {Sinapis alba} SP|P49311, {Brassica napus} SP|Q05966, {Arabidopsis thaliana} SP|Q03251; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 185 Score = 34.7 bits (76), Expect = 0.051 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 366 S+GF FV F + A+D M+G+ LDGR + Q Sbjct: 84 SKGFRFVTFKDEDSMRTAIDRMNGQELDGRNITAQ 118 >At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonucleoprotein, putative similar to GB:Y09506 from [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269 (1997)) Length = 382 Score = 34.7 bits (76), Expect = 0.051 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +1 Query: 256 RESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 375 RESRGF F+ DA + ++D +L GR + V+ AR Sbjct: 113 RESRGFGFISMKSVGDANRCIRSLDHSVLQGRVITVEKAR 152 >At1g03457.2 68414.m00327 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 438 Score = 34.7 bits (76), Expect = 0.051 Identities = 14/38 (36%), Positives = 26/38 (68%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 375 S+ F F+ + + A+ A++TM+G L G++L+VQ+ R Sbjct: 379 SKCFGFISYDSQAAAQNAINTMNGCQLSGKKLKVQLKR 416 >At1g03457.1 68414.m00326 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 429 Score = 34.7 bits (76), Expect = 0.051 Identities = 14/38 (36%), Positives = 26/38 (68%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 375 S+ F F+ + + A+ A++TM+G L G++L+VQ+ R Sbjct: 370 SKCFGFISYDSQAAAQNAINTMNGCQLSGKKLKVQLKR 407 >At5g59860.1 68418.m07506 RNA recognition motif (RRM)-containing protein similar to SP|Q14011 Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 157 Score = 34.3 bits (75), Expect = 0.068 Identities = 13/37 (35%), Positives = 26/37 (70%) Frame = +1 Query: 265 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 375 +GF F+ F DA++AL ++G++++GR + V+ A+ Sbjct: 107 KGFGFITFESEDDAQKALKALNGKIVNGRLIFVETAK 143 >At3g50670.1 68416.m05542 U1 small nuclear ribonucleoprotein 70 (U1-70k) Length = 427 Score = 34.3 bits (75), Expect = 0.068 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +1 Query: 265 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 375 +G+AF+ + RD + A DG+ +DGR + V + R Sbjct: 179 KGYAFIEYMHTRDMKAAYKQADGQKIDGRRVLVDVER 215 >At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 34.3 bits (75), Expect = 0.068 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = +1 Query: 265 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 372 RGF F+ F +RR A++A+ M GR L + + V A Sbjct: 53 RGFGFITFTDRRGADDAIKHMHGRELGNKVISVNKA 88 >At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 34.3 bits (75), Expect = 0.068 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = +1 Query: 265 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 372 RGF F+ F +RR A++A+ M GR L + + V A Sbjct: 53 RGFGFITFTDRRGADDAIKHMHGRELGNKVISVNKA 88 >At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondrial (RPS19) Length = 212 Score = 33.9 bits (74), Expect = 0.089 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +1 Query: 250 VQRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 375 V SRG+ FV F A A+ M+G+ L+G + V +A+ Sbjct: 67 VTGRSRGYGFVNFISEDSANSAISAMNGQELNGFNISVNVAK 108 >At5g06210.1 68418.m00693 RNA-binding protein, putative contains similarity to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925, [Solanum tuberosum] GI:15822705; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 33.9 bits (74), Expect = 0.089 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = +1 Query: 250 VQRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 375 V S+GF FV F +A++AL +G+ L+GR + V A+ Sbjct: 70 VSDRSKGFGFVTFASADEAQKALMEFNGQQLNGRTIFVDYAK 111 >At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing protein similar to SP|P48809 Heterogeneous nuclear ribonucleoprotein 27C (hnRNP 48) {Drosophila melanogaster}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); non-consensus TA donor splice site at exon 6 Length = 379 Score = 33.9 bits (74), Expect = 0.089 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +2 Query: 110 YGRPPPRIDGMVS-LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRD 247 YGR P G+ + + V L + +DLR F R G + D YIP+D Sbjct: 228 YGRGEPTTRGIGNKIFVGRLPQEASVDDLRDYFGRFGHIQDAYIPKD 274 Score = 30.3 bits (65), Expect = 1.1 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +2 Query: 188 DLRRVFERCGEVGDIYIPRDRYKGK 262 D R FER GE+ D+Y+P+D Y K Sbjct: 106 DFRSHFERYGEITDLYMPKD-YNSK 129 >At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing protein similar to chloroplast RNA-binding protein cp33 [Arabidopsis thaliana] GI:681912; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 253 Score = 33.9 bits (74), Expect = 0.089 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +1 Query: 259 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 372 +S GF FV F D E A+ ++ +L+G+++RV A Sbjct: 216 KSTGFGFVTFSSEEDVEAAIVALNNSLLEGQKIRVNKA 253 Score = 27.9 bits (59), Expect = 5.9 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 369 SR F F DA ++ ++G ++GRE++V + Sbjct: 116 SRRFGFATMKSVEDANAVVEKLNGNTVEGREIKVNI 151 >At2g47310.1 68415.m05906 flowering time control protein-related / FCA gamma-related Length = 512 Score = 33.9 bits (74), Expect = 0.089 Identities = 16/44 (36%), Positives = 28/44 (63%), Gaps = 1/44 (2%) Frame = +2 Query: 134 DGMVS-LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYKGK 262 DG ++ L V ++ T D+R+VFE+ G V +I +P+D+ G+ Sbjct: 106 DGSIAKLYVAPISKTATEYDIRQVFEKYGNVTEIILPKDKMTGE 149 >At1g49760.1 68414.m05580 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein GB:AAF66825 GI:7673359 from [Nicotiana tabacum] Length = 671 Score = 33.9 bits (74), Expect = 0.089 Identities = 16/44 (36%), Positives = 25/44 (56%) Frame = +1 Query: 244 RSVQRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 375 R + +S+GF FV F DA A+D ++G+ D +E V A+ Sbjct: 257 RDGEGKSKGFGFVNFENSDDAARAVDALNGKTFDDKEWFVGKAQ 300 Score = 28.7 bits (61), Expect = 3.4 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 375 SRG FV F +A A+ M+G+M+ + L V +A+ Sbjct: 366 SRGSGFVAFSTPEEATRAITEMNGKMIVTKPLYVALAQ 403 Score = 27.9 bits (59), Expect = 5.9 Identities = 10/35 (28%), Positives = 24/35 (68%) Frame = +1 Query: 259 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 363 +S+G+ FV++ A+ A+D ++G +L+ +++ V Sbjct: 171 QSKGYGFVQYDTDEAAQGAIDKLNGMLLNDKQVYV 205 >At5g03580.1 68418.m00316 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein [Triticum aestivum] GI:1737492; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 101 Score = 33.5 bits (73), Expect = 0.12 Identities = 17/36 (47%), Positives = 22/36 (61%) Frame = +1 Query: 259 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 366 ESRGFAF+ F A A+ MDGR++ + L VQ Sbjct: 55 ESRGFAFIEFESADSAGRAMLHMDGRLIGQKILCVQ 90 >At5g51120.1 68418.m06339 polyadenylate-binding protein, putative / PABP, putative contains similarity to poly(A)-binding protein II [Mus musculus] GI:2351846; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 227 Score = 33.1 bits (72), Expect = 0.16 Identities = 13/36 (36%), Positives = 23/36 (63%) Frame = +2 Query: 146 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRY 253 S+ V N+ Y TPE++++ F+ CG V + I D++ Sbjct: 104 SIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKF 139 >At3g55340.1 68416.m06146 RNA recognition motif (RRM)-containing protein low similarity to nucleolar phosphoprotein (Nopp52), Tetrahymena thermophila, EMBL:TT51555; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 597 Score = 33.1 bits (72), Expect = 0.16 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 101 KMSYGRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERC 214 K S G P +DG + + NL + TT D+R++F C Sbjct: 248 KTSSGFAPEMVDGYNRVYIGNLAWDTTERDIRKLFSDC 285 >At3g54230.1 68416.m05994 zinc finger protein-related / D111/G-patch domain-containing protein / RNA recognition motif (RRM)-containing protein KIAA0122 gene , Homo sapiens, EMBL:HSDKG02; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF01585: G-patch domain, weak hit to PF00641: Zn-finger in Ran binding protein and others Length = 1105 Score = 33.1 bits (72), Expect = 0.16 Identities = 18/40 (45%), Positives = 25/40 (62%), Gaps = 2/40 (5%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLD--GRELRVQMAR 375 SRGFAFV F+ DA +AL+ + L+ G+ LRV A+ Sbjct: 498 SRGFAFVHFYSVEDATKALEATNRTALERNGKILRVAYAK 537 >At3g19130.1 68416.m02429 RNA-binding protein, putative similar to RNA Binding Protein 47 [Nicotiana plumbaginifolia] GI:9663769, DNA binding protein ACBF GB:AAC49850 from [Nicotiana tabacum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 435 Score = 33.1 bits (72), Expect = 0.16 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 372 S+G+ FVRF + + AL M+G R++RV +A Sbjct: 243 SKGYGFVRFGDENERSRALTEMNGAYCSNRQMRVGIA 279 >At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing protein Length = 561 Score = 33.1 bits (72), Expect = 0.16 Identities = 17/41 (41%), Positives = 22/41 (53%) Frame = +2 Query: 125 PRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRD 247 P G L V NL + +DLR+VFE G V + +PRD Sbjct: 279 PYSGGARRLYVGNLHINMSEDDLRKVFESFGSVELVQVPRD 319 >At5g16260.1 68418.m01899 RNA recognition motif (RRM)-containing protein similar to Tat-SF1 - Homo sapiens, GI:1667611; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 519 Score = 32.7 bits (71), Expect = 0.21 Identities = 13/44 (29%), Positives = 25/44 (56%) Frame = +1 Query: 238 SQRSVQRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 369 S + + +G VRF +RRDA++ ++ M+GR R++ + Sbjct: 445 SVKVCEHHPQGVVLVRFKDRRDAQKCIEAMNGRWYAKRQIHASL 488 >At5g07290.1 68418.m00832 RNA recognition motif (RRM)-containing protein Mei2-like protein - Arabidopsis thaliana, EMBL:D86122 Length = 907 Score = 32.7 bits (71), Expect = 0.21 Identities = 13/36 (36%), Positives = 25/36 (69%) Frame = +1 Query: 259 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 366 ++RGF V +++ R A++A + GR+L GR+L ++ Sbjct: 245 KNRGFIMVSYYDIRAAQKAARALHGRLLRGRKLDIR 280 >At2g35410.1 68415.m04340 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to SP|P19684 33 kDa ribonucleoprotein, chloroplast precursor {Nicotiana sylvestris}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 308 Score = 32.7 bits (71), Expect = 0.21 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = +1 Query: 244 RSVQRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 375 R ++RGFAFV +A+ A+D D + GR + V AR Sbjct: 128 RQKDGKNRGFAFVTMASGEEAQAAIDKFDTFQVSGRIISVSFAR 171 >At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein ACBF GB:U90212 GI:1899187 from [Nicotiana tabacum] Length = 445 Score = 32.7 bits (71), Expect = 0.21 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 372 S+G+ FVRF + + A+ M+G R++RV +A Sbjct: 254 SKGYGFVRFGDENERSRAMTEMNGAFCSSRQMRVGIA 290 >At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative Length = 425 Score = 32.3 bits (70), Expect = 0.27 Identities = 17/54 (31%), Positives = 27/54 (50%) Frame = +2 Query: 107 SYGRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYKGKVE 268 +Y PP ++ V NL T E+L++ F + GEV + IP + G V+ Sbjct: 225 AYVAPPESDVTCTTISVANLDQNVTEEELKKAFSQLGEVIYVKIPATKGYGYVQ 278 Score = 29.1 bits (62), Expect = 2.5 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 372 S+G+ FV+F E + A+ M+G R +R+ A Sbjct: 157 SKGYGFVKFAEESERNRAMAEMNGLYCSTRPMRISAA 193 >At5g04280.1 68418.m00421 glycine-rich RNA-binding protein Length = 310 Score = 32.3 bits (70), Expect = 0.27 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 372 SRGF F+ F +RR +E++ M GR R + V A Sbjct: 47 SRGFGFITFADRRAMDESIREMHGRDFGDRVISVNRA 83 >At4g12640.1 68417.m01989 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 823 Score = 32.3 bits (70), Expect = 0.27 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +1 Query: 265 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 375 R +AFV F DA A++++ G L G LR++ A+ Sbjct: 58 RSYAFVNFNHDEDAFAAIESLQGFPLSGNPLRIEFAK 94 >At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) Length = 660 Score = 32.3 bits (70), Expect = 0.27 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = +1 Query: 253 QRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 375 Q SRGF FV + +A AL M+G+M+ + L + +A+ Sbjct: 368 QGMSRGFGFVAYSNPEEALRALSEMNGKMIGRKPLYIALAQ 408 Score = 30.3 bits (65), Expect = 1.1 Identities = 11/38 (28%), Positives = 25/38 (65%) Frame = +1 Query: 250 VQRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 363 V S+G+ FV+F + A+ A+D ++G +++ +++ V Sbjct: 171 VTGRSKGYGFVQFEKEESAQAAIDKLNGMLMNDKQVFV 208 >At2g36660.1 68415.m04496 polyadenylate-binding protein, putative / PABP, putative Length = 609 Score = 31.9 bits (69), Expect = 0.36 Identities = 15/39 (38%), Positives = 24/39 (61%) Frame = +1 Query: 259 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 375 +S+GF FV F +A +A+ T G+M G+ L V +A+ Sbjct: 342 KSKGFGFVCFSTPEEAIDAVKTFHGQMFHGKPLYVAIAQ 380 Score = 28.7 bits (61), Expect = 3.4 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +1 Query: 256 RESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 375 R RG+AFV F DA A +T++G + L V A+ Sbjct: 238 RLCRGYAFVNFDNPEDARRAAETVNGTKFGSKCLYVGRAQ 277 >At2g27330.1 68415.m03286 RNA recognition motif (RRM)-containing protein Length = 116 Score = 31.9 bits (69), Expect = 0.36 Identities = 12/29 (41%), Positives = 22/29 (75%) Frame = +1 Query: 265 RGFAFVRFFERRDAEEALDTMDGRMLDGR 351 +GFA+V F + +AE+AL ++ +++DGR Sbjct: 62 KGFAYVTFSSKEEAEKALLELNAQLVDGR 90 >At5g65260.1 68418.m08209 polyadenylate-binding protein family protein / PABP family protein low similarity to poly(A)-binding protein II [Drosophila melanogaster] GI:6007612; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 220 Score = 31.5 bits (68), Expect = 0.48 Identities = 13/36 (36%), Positives = 23/36 (63%) Frame = +2 Query: 146 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRY 253 S+ V N+ Y TPE++++ F+ CG V + I D++ Sbjct: 93 SVFVGNVDYACTPEEVQQHFQTCGTVHRVTILTDKF 128 Score = 29.1 bits (62), Expect = 2.5 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +1 Query: 259 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 375 + +GFA+V F E +EAL + L GR+L+V R Sbjct: 130 QPKGFAYVEFVEVEAVQEALQLNESE-LHGRQLKVLQKR 167 >At5g10350.2 68418.m01201 polyadenylate-binding protein family protein / PABP family protein contains weak similarity to poly(A) binding protein II from [Mus musculus] GI:2351846, [Xenopus laevis] GI:11527140; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 202 Score = 31.5 bits (68), Expect = 0.48 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +2 Query: 146 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRY 253 S+ V N+ Y TPE+++ F+ CG V + I D++ Sbjct: 90 SVYVGNVDYACTPEEVQLHFQTCGTVNRVTILMDKF 125 Score = 29.1 bits (62), Expect = 2.5 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +1 Query: 259 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 375 + +GFA+V F E +EAL + L GR+L+V R Sbjct: 127 QPKGFAYVEFVEVEAVQEALQLNESE-LHGRQLKVSPKR 164 >At5g10350.1 68418.m01200 polyadenylate-binding protein family protein / PABP family protein contains weak similarity to poly(A) binding protein II from [Mus musculus] GI:2351846, [Xenopus laevis] GI:11527140; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 217 Score = 31.5 bits (68), Expect = 0.48 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +2 Query: 146 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRY 253 S+ V N+ Y TPE+++ F+ CG V + I D++ Sbjct: 90 SVYVGNVDYACTPEEVQLHFQTCGTVNRVTILMDKF 125 Score = 29.1 bits (62), Expect = 2.5 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +1 Query: 259 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 375 + +GFA+V F E +EAL + L GR+L+V R Sbjct: 127 QPKGFAYVEFVEVEAVQEALQLNESE-LHGRQLKVSPKR 164 >At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2) non-consensus TA donor splice site at exon 2, polyadenylate-binding protein - Triticum aestivum (common wheat),PIR:T06979 Length = 443 Score = 31.5 bits (68), Expect = 0.48 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = +1 Query: 259 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 375 +S+GF FV F DA A+++++G D +E V A+ Sbjct: 67 KSKGFGFVNFENADDAARAVESLNGHKFDDKEWYVGRAQ 105 Score = 30.7 bits (66), Expect = 0.83 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 375 S+G FV F +A EA+ + G+M++ + L V +A+ Sbjct: 171 SKGSGFVAFATPEEATEAMSQLSGKMIESKPLYVAIAQ 208 >At2g37510.1 68415.m04600 RNA-binding protein, putative similar to SP|P10979 Glycine-rich RNA-binding, abscisic acid-inducible protein {Zea mays}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 142 Score = 31.5 bits (68), Expect = 0.48 Identities = 16/38 (42%), Positives = 22/38 (57%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 375 S+GF FV + DAE+A M+ + LDG + V AR Sbjct: 74 SKGFGFVTYATIEDAEKAKAEMNAKFLDGWVIFVDPAR 111 >At2g23350.1 68415.m02788 polyadenylate-binding protein, putative / PABP, putative Length = 662 Score = 31.5 bits (68), Expect = 0.48 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 375 S+G FV F +A L+ M+G+M+ G+ L V +A+ Sbjct: 367 SKGSGFVAFSAASEASRVLNEMNGKMVGGKPLYVALAQ 404 >At1g16610.2 68414.m01990 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 407 Score = 31.5 bits (68), Expect = 0.48 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +1 Query: 265 RGFAFVRFFERRDAEEALDTMDGRMLDGRELR 360 RG +V F R DAE+A MDG +DG+ ++ Sbjct: 139 RGHGYVEFKARADAEKAQLYMDGAQIDGKVVK 170 >At1g16610.1 68414.m01989 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 414 Score = 31.5 bits (68), Expect = 0.48 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +1 Query: 265 RGFAFVRFFERRDAEEALDTMDGRMLDGRELR 360 RG +V F R DAE+A MDG +DG+ ++ Sbjct: 139 RGHGYVEFKARADAEKAQLYMDGAQIDGKVVK 170 >At1g07350.2 68414.m00784 transformer serine/arginine-rich ribonucleoprotein, putative similar to GB:Y09506 from [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269 (1997)) Length = 129 Score = 31.5 bits (68), Expect = 0.48 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +1 Query: 256 RESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 366 RESRGF F+ DA + ++D +L GR + V+ Sbjct: 83 RESRGFGFISMKSVGDANRCIRSLDHSVLQGRVITVE 119 >At5g51300.2 68418.m06360 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 31.1 bits (67), Expect = 0.63 Identities = 13/37 (35%), Positives = 24/37 (64%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 372 S+G+ FV++ + + A A+ M+G +GR L V++A Sbjct: 520 SKGYGFVKYADVQMANTAVQAMNGYRFEGRTLAVRIA 556 >At5g51300.1 68418.m06359 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 31.1 bits (67), Expect = 0.63 Identities = 13/37 (35%), Positives = 24/37 (64%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 372 S+G+ FV++ + + A A+ M+G +GR L V++A Sbjct: 520 SKGYGFVKYADVQMANTAVQAMNGYRFEGRTLAVRIA 556 >At4g35785.2 68417.m05083 transformer serine/arginine-rich ribonucleoprotein, putative similar to transformer-SR ribonucleoprotein [Nicotiana tabacum] gi|1781299|emb|CAA70700 Length = 141 Score = 31.1 bits (67), Expect = 0.63 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +1 Query: 256 RESRGFAFVRFFERRDAEEALDTMDGRMLDGR 351 R SRGFAFV +DAE + ++ +L+GR Sbjct: 110 RVSRGFAFVTMSSLKDAERCIKYLNQSVLEGR 141 >At4g35785.1 68417.m05082 transformer serine/arginine-rich ribonucleoprotein, putative similar to transformer-SR ribonucleoprotein [Nicotiana tabacum] gi|1781299|emb|CAA70700 Length = 140 Score = 31.1 bits (67), Expect = 0.63 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +1 Query: 256 RESRGFAFVRFFERRDAEEALDTMDGRMLDGR 351 R SRGFAFV +DAE + ++ +L+GR Sbjct: 109 RVSRGFAFVTMSSLKDAERCIKYLNQSVLEGR 140 >At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 352 Score = 31.1 bits (67), Expect = 0.63 Identities = 12/35 (34%), Positives = 25/35 (71%) Frame = +1 Query: 259 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 363 +S+GFAF+ + ++R A+D ++G ++ GR ++V Sbjct: 75 KSKGFAFLAYEDQRSTILAVDNLNGALVLGRTIKV 109 Score = 27.9 bits (59), Expect = 5.9 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +2 Query: 155 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYKGK 262 V + + T DL VF + GE+ D+ + RD+ GK Sbjct: 40 VGGIPFDLTEGDLLAVFSQYGEIVDVNLIRDKGTGK 75 >At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 271 Score = 31.1 bits (67), Expect = 0.63 Identities = 17/52 (32%), Positives = 26/52 (50%) Frame = +2 Query: 107 SYGRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYKGK 262 SY R P + V L + T +++RR FE+ GE+ + I D+ GK Sbjct: 5 SYYRSPFGDTTYTKVFVGGLAWETPTDEMRRYFEQFGEILEAVIITDKNTGK 56 >At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 287 Score = 31.1 bits (67), Expect = 0.63 Identities = 17/52 (32%), Positives = 26/52 (50%) Frame = +2 Query: 107 SYGRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYKGK 262 SY R P + V L + T +++RR FE+ GE+ + I D+ GK Sbjct: 5 SYYRSPFGDTTYTKVFVGGLAWETPTDEMRRYFEQFGEILEAVIITDKNTGK 56 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 30.7 bits (66), Expect = 0.83 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +2 Query: 155 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYKGK 262 V L + T EDL+R F + G+V D I DR G+ Sbjct: 10 VGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGR 45 >At4g09040.1 68417.m01491 RNA recognition motif (RRM)-containing protein low similarity to enhancer binding protein-1; EBP1 [Entamoeba histolytica] GI:8163877, SP|P19682 28 kDa ribonucleoprotein, chloroplast precursor (28RNP) {Nicotiana sylvestris}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 304 Score = 30.7 bits (66), Expect = 0.83 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +2 Query: 149 LKVDNLTYRTTPEDLRRVFERCGEVGDI 232 L N+ + +TPED+R +FE+ G V DI Sbjct: 96 LIAQNVPWTSTPEDIRSLFEKYGSVIDI 123 >At4g16280.3 68417.m02471 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 533 Score = 30.3 bits (65), Expect = 1.1 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +2 Query: 149 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYK 256 L V +L + T +++ +F + G V D+Y+ RD Y+ Sbjct: 213 LFVGSLNKQATEKEVEEIFLQFGHVEDVYLMRDEYR 248 >At4g16280.2 68417.m02470 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 747 Score = 30.3 bits (65), Expect = 1.1 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +2 Query: 149 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYK 256 L V +L + T +++ +F + G V D+Y+ RD Y+ Sbjct: 213 LFVGSLNKQATEKEVEEIFLQFGHVEDVYLMRDEYR 248 >At3g20930.1 68416.m02645 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif Length = 374 Score = 30.3 bits (65), Expect = 1.1 Identities = 12/42 (28%), Positives = 26/42 (61%) Frame = +1 Query: 250 VQRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 375 + + S+G+AF+ + A AL M+G++++G + V +A+ Sbjct: 318 ISKRSKGYAFLEYTTEEAAGTALKEMNGKIINGWMIVVDVAK 359 >At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profile: PF00076 RNA recognition motif Length = 636 Score = 30.3 bits (65), Expect = 1.1 Identities = 12/36 (33%), Positives = 26/36 (72%) Frame = +1 Query: 265 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 372 +G+ + F +A++AL+ M+G++L GR++R+ +A Sbjct: 424 KGYGHIEFASPEEAQKALE-MNGKLLLGRDVRLDLA 458 Score = 29.9 bits (64), Expect = 1.5 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +2 Query: 185 EDLRRVFERCGEVGDIYIPRDRYKG 259 ++LR F +CGEV +++P DR G Sbjct: 497 KELRSHFSKCGEVTRVHVPTDRETG 521 >At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5) identical to GB:Q05196 from [Arabidopsis thaliana] Length = 668 Score = 30.3 bits (65), Expect = 1.1 Identities = 11/34 (32%), Positives = 24/34 (70%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 363 S+G+ FV+F + A+ A+D ++G +L+ +++ V Sbjct: 171 SKGYGFVQFEKEETAQAAIDKLNGMLLNDKQVFV 204 Score = 29.9 bits (64), Expect = 1.5 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 375 SRGF FV + +A A+ M+G+M+ + L V +A+ Sbjct: 367 SRGFGFVAYSNPEEALLAMKEMNGKMIGRKPLYVALAQ 404 >At1g34140.1 68414.m04235 polyadenylate-binding protein, putative / PABP, putative non-consensus splice donor TA at exon 1; similar to polyadenylate-binding protein (poly(A)-binding protein) from [Triticum aestivum] GI:1737492, [Nicotiana tabacum] GI:7673355, {Arabidopsis thaliana} SP|P42731; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 407 Score = 30.3 bits (65), Expect = 1.1 Identities = 15/39 (38%), Positives = 24/39 (61%) Frame = +1 Query: 259 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 375 +SR F FV F + A A++ M+G ++D +EL V A+ Sbjct: 157 KSRRFGFVNFEKAEAAVTAIEKMNGVVVDEKELHVGRAQ 195 Score = 29.1 bits (62), Expect = 2.5 Identities = 12/38 (31%), Positives = 23/38 (60%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 375 S+G FV F +A +A+ M+G+M+ + + V +A+ Sbjct: 262 SKGVGFVEFSTSEEASKAMLKMNGKMVGNKPIYVSLAQ 299 >At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putative similar to glycine-rich RNA-binding protein from {Sorghum bicolor} SP|Q99070, GI:1778373 from [Pisum sativum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 155 Score = 30.3 bits (65), Expect = 1.1 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMARYG 381 SRGF FV + A A+ M + LDGR + V A G Sbjct: 76 SRGFGFVTYDSIEVANNAMQAMQNKELDGRIIGVHPADSG 115 >At5g52040.2 68418.m06459 arginine/serine-rich splicing factor RSP41 (RSP41) nearly identical to SP|P92966 Arginine/serine-rich splicing factor RSP41 {Arabidopsis thaliana} Length = 357 Score = 29.9 bits (64), Expect = 1.5 Identities = 18/40 (45%), Positives = 24/40 (60%), Gaps = 4/40 (10%) Frame = +1 Query: 268 GFAFVRFFERRDAEEALDTMD----GRMLDGRELRVQMAR 375 GFAFV + RDAE+A+ +D GR GR LRV+ + Sbjct: 36 GFAFVYMEDERDAEDAIRALDRFEYGR--TGRRLRVEWTK 73 >At5g52040.1 68418.m06458 arginine/serine-rich splicing factor RSP41 (RSP41) nearly identical to SP|P92966 Arginine/serine-rich splicing factor RSP41 {Arabidopsis thaliana} Length = 356 Score = 29.9 bits (64), Expect = 1.5 Identities = 18/40 (45%), Positives = 24/40 (60%), Gaps = 4/40 (10%) Frame = +1 Query: 268 GFAFVRFFERRDAEEALDTMD----GRMLDGRELRVQMAR 375 GFAFV + RDAE+A+ +D GR GR LRV+ + Sbjct: 36 GFAFVYMEDERDAEDAIRALDRFEYGR--TGRRLRVEWTK 73 >At5g03480.1 68418.m00304 expressed protein ; expression supported by MPSS Length = 321 Score = 29.9 bits (64), Expect = 1.5 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = +2 Query: 191 LRRVFERCGEVGDIYIPRDRYKGKVEDSPS 280 L + F CGE+ IY+PRD +K K+ S S Sbjct: 44 LTKHFASCGEITQIYVPRD-FKKKILKSVS 72 Score = 27.9 bits (59), Expect = 5.9 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = +2 Query: 191 LRRVFERCGEVGDIYIPRDRYKG 259 L + F+ CGE+ +Y+P D +G Sbjct: 133 LEKHFDSCGEIRHVYVPTDYERG 155 >At4g25500.1 68417.m03673 arginine/serine-rich splicing factor RSP40 (RSP40) identical to SP|P92965 Arginine/serine-rich splicing factor RSP40 {Arabidopsis thaliana} Length = 350 Score = 29.9 bits (64), Expect = 1.5 Identities = 18/40 (45%), Positives = 24/40 (60%), Gaps = 4/40 (10%) Frame = +1 Query: 268 GFAFVRFFERRDAEEALDTMD----GRMLDGRELRVQMAR 375 GFAFV + RDAE+A+ +D GR GR LRV+ + Sbjct: 36 GFAFVYMEDERDAEDAIRALDRFEFGR--KGRRLRVEWTK 73 >At3g16380.1 68416.m02074 polyadenylate-binding protein, putative / PABP, putative similar to polyadenylate-binding protein (poly(A)-binding protein) from {Arabidopsis thaliana} SP|P42731, [Cucumis sativus] GI:7528270, {Homo sapiens} SP|Q13310, {Arabidopsis thaliana} SP|Q05196; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 537 Score = 29.9 bits (64), Expect = 1.5 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 372 SRGF FV F +A++A++++ G L ++L V A Sbjct: 241 SRGFGFVNFCNPENAKKAMESLCGLQLGSKKLFVGKA 277 Score = 28.7 bits (61), Expect = 3.4 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +1 Query: 259 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 363 +S+GF FV+F + A A + G M+ G++L V Sbjct: 149 QSKGFGFVQFDTEQSAVSARSALHGSMVYGKKLFV 183 Score = 28.7 bits (61), Expect = 3.4 Identities = 12/37 (32%), Positives = 25/37 (67%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 372 S+GF FV F ++++A ++G ++DG+ + V++A Sbjct: 343 SKGFGFVCFSNCEESKQAKRYLNGFLVDGKPIVVRVA 379 >At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative similar to SP|Q15427 Splicing factor 3B subunit 4 (Spliceosome associated protein 49) (SAP 49) (SF3b50) (Pre-mRNA splicing factor SF3b 49 kDa subunit) {Homo sapiens}; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 363 Score = 29.9 bits (64), Expect = 1.5 Identities = 12/37 (32%), Positives = 22/37 (59%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 372 SRGF F+ + ++ A+++M G+ L R++ V A Sbjct: 153 SRGFGFISYDSFEASDAAIESMTGQYLSNRQITVSYA 189 >At1g01080.1 68414.m00010 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to 33 KDA RIBONUCLEOPROTEIN GB:P19684 from [Nicotiana sylvestris] Length = 293 Score = 29.9 bits (64), Expect = 1.5 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = +1 Query: 259 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 366 ESRG +V A+ A+ ++DG + GRE+RV+ Sbjct: 147 ESRGSGYVTMGSINSAKIAIASLDGTEVGGREMRVR 182 >At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-like SR protein (SRZ22) identical to RSZp22 protein [Arabidopsis thaliana] gi|2582645|emb|CAA05352, 9G8-like SR protein [Arabidopsis thaliana] GI:3435094; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) and PF00098: Zinc knuckle; identical to cDNA 9G8-like SR protein (SRZ22) GI:3435093 Length = 200 Score = 29.5 bits (63), Expect = 1.9 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +1 Query: 250 VQRESRGFAFVRFFERRDAEEALDTMDGR 336 V R G+AF+ F + RDA +A+ +DG+ Sbjct: 33 VARRPPGYAFLDFEDPRDARDAIRALDGK 61 >At2g46610.2 68415.m05813 arginine/serine-rich splicing factor, putative similar to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 224 Score = 29.5 bits (63), Expect = 1.9 Identities = 15/31 (48%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +1 Query: 256 RESRGFAFVRFFERRDAEEALD-TMDGRMLD 345 R R FAFV+F + DA +ALD T + ++LD Sbjct: 100 RMRRNFAFVQFATQEDATKALDSTHNSKLLD 130 Score = 27.5 bits (58), Expect = 7.8 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Frame = +1 Query: 268 GFAFVRFFERRDAEEALDTMDGRML--DGRELRVQMAR 375 G+AFV F + RDAE+A+ D R+L V+ A+ Sbjct: 10 GYAFVYFEDERDAEDAIRRTDNTTFGYGRRKLSVEWAK 47 >At2g46610.1 68415.m05814 arginine/serine-rich splicing factor, putative similar to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 250 Score = 29.5 bits (63), Expect = 1.9 Identities = 15/31 (48%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +1 Query: 256 RESRGFAFVRFFERRDAEEALD-TMDGRMLD 345 R R FAFV+F + DA +ALD T + ++LD Sbjct: 126 RMRRNFAFVQFATQEDATKALDSTHNSKLLD 156 Score = 27.5 bits (58), Expect = 7.8 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Frame = +1 Query: 268 GFAFVRFFERRDAEEALDTMDGRML--DGRELRVQMAR 375 G+AFV F + RDAE+A+ D R+L V+ A+ Sbjct: 36 GYAFVYFEDERDAEDAIRRTDNTTFGYGRRKLSVEWAK 73 >At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 29.5 bits (63), Expect = 1.9 Identities = 16/52 (30%), Positives = 26/52 (50%) Frame = +2 Query: 107 SYGRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYKGK 262 SY R P + V L + T +++RR F++ GE+ + I D+ GK Sbjct: 5 SYYRSPFGDTTHTKVFVGGLAWETPTDEMRRYFDQFGEILEAVIITDKATGK 56 >At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putative contains similarity to polyadenylate-binding protein 5 Length = 387 Score = 29.1 bits (62), Expect = 2.5 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 363 S+G+ FVRF + + A+ M+G+ R +R+ Sbjct: 195 SKGYGFVRFADENEQMRAMTEMNGQYCSTRPMRI 228 >At3g09160.1 68416.m01082 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 198 Score = 29.1 bits (62), Expect = 2.5 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = +2 Query: 188 DLRRVFERCGEVGDIYIPRDR 250 +L+++F CGE+ D++IP R Sbjct: 42 ELKKLFSPCGEITDVHIPETR 62 >At2g37340.2 68415.m04579 splicing factor RSZ33 (RSZ33) nearly identical to splicing factor RSZ33 [Arabidopsis thaliana] GI:9843663; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00098: Zinc knuckle Length = 260 Score = 29.1 bits (62), Expect = 2.5 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 375 S F F + RDA++A +DGR DG + V+ +R Sbjct: 13 SSHFRNQEFGDPRDADDARHYLDGRDFDGSRITVEFSR 50 >At2g24590.1 68415.m02936 splicing factor, putative similar to to RSZp22 protein [Arabidopsis thaliana] gi|2582645|emb|CAA05352 Length = 196 Score = 29.1 bits (62), Expect = 2.5 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +1 Query: 250 VQRESRGFAFVRFFERRDAEEALDTMDGR 336 V R G+AF+ F + RDA +A+ +DG+ Sbjct: 33 VARRPPGYAFLDFEDSRDARDAIREVDGK 61 >At5g19030.2 68418.m02262 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 126 Score = 28.7 bits (61), Expect = 3.4 Identities = 10/28 (35%), Positives = 20/28 (71%) Frame = +1 Query: 256 RESRGFAFVRFFERRDAEEALDTMDGRM 339 R+S G+ +V F + DA+ A++ M+G++ Sbjct: 96 RQSLGYGYVWFNSKEDAQSAVEAMNGKV 123 >At1g51510.1 68414.m05797 RNA-binding protein, putative similar to RNA-binding protein 8 (Ribonucleoprotein RBM8) SP:Q9Y5S9 from [Homo sapiens], RNA-binding protein Y14 [Xenopus laevis] GI:11034807; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 202 Score = 28.7 bits (61), Expect = 3.4 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 2/56 (3%) Frame = +2 Query: 107 SYGRPPPR--IDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYKGKVE 268 S GRP P+ ++G + L V + T ED+ F GE+ ++ + DR G V+ Sbjct: 82 SDGRPGPQRSVEGWIIL-VSGVHEETQEEDITNAFGDFGEIKNLNLNLDRRSGYVK 136 >At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 434 Score = 28.7 bits (61), Expect = 3.4 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 363 S+G+ FVRF + + +A+ M+G R +R+ Sbjct: 240 SKGYGFVRFGDENERTKAMTEMNGVKCSSRAMRI 273 >At1g47490.2 68414.m05269 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 310 Score = 28.7 bits (61), Expect = 3.4 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 363 S+G+ FVRF + + +A+ M+G R +R+ Sbjct: 238 SKGYGFVRFGDENERTKAMTEMNGVKCSSRAMRI 271 >At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 432 Score = 28.7 bits (61), Expect = 3.4 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 363 S+G+ FVRF + + +A+ M+G R +R+ Sbjct: 238 SKGYGFVRFGDENERTKAMTEMNGVKCSSRAMRI 271 >At3g61860.1 68416.m06947 arginine/serine-rich splicing factor RSP31 (RSP31) identical to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 264 Score = 28.3 bits (60), Expect = 4.4 Identities = 15/38 (39%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 268 GFAFVRFFERRDAEEALDTMDGRML--DGRELRVQMAR 375 G+AFV F + RDAE+A+ +D + R L V+ A+ Sbjct: 36 GYAFVYFEDERDAEDAIRKLDNFPFGYEKRRLSVEWAK 73 >At3g56430.1 68416.m06276 expressed protein unknown protein At2g40800 - Arabidopsis thaliana, EMBL:AC007660 Length = 434 Score = 28.3 bits (60), Expect = 4.4 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = -1 Query: 378 ISRHLNAKFPAVQHSSVHRVQGFFSITTLEKPYEGESSTFPLYR-SLGM 235 ++ + + F S +V G F+ ++KP + SSTF YR +LG+ Sbjct: 125 VNMNFVSAFRLFSSSGFRKVDGNFARKVVDKPIKAVSSTFARYRMALGL 173 >At3g53830.1 68416.m05947 regulator of chromosome condensation (RCC1) family protein / UVB-resistance protein-related contains Pfam PF00415 : Regulator of chromosome condensation (RCC1); similar to UVB-resistance protein UVR8 (GIi;10177674) [Arabidopsis thaliana] Length = 487 Score = 28.3 bits (60), Expect = 4.4 Identities = 16/55 (29%), Positives = 21/55 (38%) Frame = -3 Query: 487 CGNGCGYDCASNYDGGNETWTCACDRNDSCMAMRGDHIAPSEREVPCRPTFVRPS 323 CG GCG+ A + G TW D S +A P +P V+ S Sbjct: 57 CGGGCGFAMAISEKGKLITWGSTDDEGQSYVASGKHGETPEPFPLPTEAPVVQAS 111 >At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 304 Score = 28.3 bits (60), Expect = 4.4 Identities = 14/55 (25%), Positives = 26/55 (47%) Frame = +2 Query: 98 FKMSYGRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYKGK 262 F+M G + + V L + T + +RR FE+ GE+ + + D+ G+ Sbjct: 7 FQMEGGNNNTTDTKLTKIFVGGLAWETQRDTMRRYFEQFGEIVEAVVITDKNTGR 61 >At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 347 Score = 28.3 bits (60), Expect = 4.4 Identities = 16/41 (39%), Positives = 24/41 (58%) Frame = +1 Query: 259 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMARYG 381 +++GF FV F R+ A+EAL R+L+ R Q+A G Sbjct: 143 KAKGFGFVMFKTRKGAKEALKEPKKRILN-RTATCQLASMG 182 >At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 343 Score = 28.3 bits (60), Expect = 4.4 Identities = 16/41 (39%), Positives = 24/41 (58%) Frame = +1 Query: 259 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMARYG 381 +++GF FV F R+ A+EAL R+L+ R Q+A G Sbjct: 143 KAKGFGFVMFKTRKGAKEALKEPKKRILN-RTATCQLASMG 182 >At1g47620.1 68414.m05289 cytochrome P450, putative similar to cytochrome P450 GI:4688670 from [Catharanthus roseus] Length = 520 Score = 28.3 bits (60), Expect = 4.4 Identities = 14/41 (34%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = +3 Query: 141 WSR*K*IILPTERR-LKTYAAFSKGAEKLVISTFPEIGTKG 260 W K I + TE++ LK +A F + EK++ + E+G++G Sbjct: 235 WKLQKWIGIGTEKKMLKAHATFDRVCEKIIAAKREELGSQG 275 >At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putative DNA binding protein ACBF - Nicotiana tabacum, PID:g1899188 Length = 415 Score = 27.9 bits (59), Expect = 5.9 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +1 Query: 262 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELR 360 S+G+ FVRF + + A+ M+G+ R +R Sbjct: 214 SKGYGFVRFADESEQIRAMTEMNGQYCSSRPMR 246 >At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing protein similar to nucleolin protein; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 495 Score = 27.9 bits (59), Expect = 5.9 Identities = 10/38 (26%), Positives = 24/38 (63%) Frame = +1 Query: 259 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 372 +S+G+AFV F + A++A++ + + G+ +R ++ Sbjct: 155 DSKGYAFVAFKTKDVAQKAIEELHSKEFKGKTIRCSLS 192 Score = 27.9 bits (59), Expect = 5.9 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +2 Query: 146 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIP 241 +L V N+ T+ E L+ +F+R GEV I P Sbjct: 293 ALYVKNIPENTSTEQLKELFQRHGEVTKIVTP 324 >At3g52660.1 68416.m05801 RNA recognition motif (RRM)-containing protein heterogeneous nuclear ribonucleoprotein R, Homo sapiens, PIR:T02673; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 471 Score = 27.9 bits (59), Expect = 5.9 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = +1 Query: 259 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELR 360 + +G+AFV F + A EA+DT++ G+ ++ Sbjct: 131 DGKGYAFVTFRSKDLAAEAIDTLNNTDFRGKRIK 164 >At1g75820.1 68414.m08807 CLAVATA1 receptor kinase (CLV1) identical to receptor kinase (CLV1) GB:AAB58929 GI:2160756 [Arabidopsis thaliana] Length = 980 Score = 27.9 bits (59), Expect = 5.9 Identities = 14/54 (25%), Positives = 28/54 (51%) Frame = +2 Query: 113 GRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYKGKVEDS 274 G PP + G+VSLK +L+ ++ + F G + I + R+ G++ ++ Sbjct: 279 GHIPPELSGLVSLKSLDLSINQLTGEIPQSFINLGNITLINLFRNNLYGQIPEA 332 >At1g07600.1 68414.m00813 metallothionein-like protein 1A (MT-1A) (MT-Q) (MT-2) identical to Metallothionein-like protein 1A (MT-1A) (MT-Q) (MT-2) SP:P43392 from (Arabidopsis thaliana) Length = 45 Score = 27.9 bits (59), Expect = 5.9 Identities = 13/38 (34%), Positives = 19/38 (50%), Gaps = 4/38 (10%) Frame = -3 Query: 499 SESDCGNG----CGYDCASNYDGGNETWTCACDRNDSC 398 ++S+CG G CG C+ + E C+C N SC Sbjct: 2 ADSNCGCGSSCKCGDSCSCEKNYNKECDNCSCGSNCSC 39 >At5g40510.1 68418.m04914 expressed protein Length = 333 Score = 27.5 bits (58), Expect = 7.8 Identities = 23/58 (39%), Positives = 30/58 (51%), Gaps = 3/58 (5%) Frame = +2 Query: 200 VFERCGEVGDIYIPRD--RYKGKVEDSPS*GF-SSVVMLKKPWTRWTDECWTAGNFAF 364 V E G GD+ I D RYKG V+D+ GF V++ KPW+ E +G F F Sbjct: 83 VCEGGGSDGDVLIFPDMIRYKG-VKDTDVEGFFEDVLVNGKPWSSGIQE-EISGTFVF 138 >At5g03500.1 68418.m00306 transcriptional co-activator-related low similarity to transcriptional co-activator CRSP33 [Homo sapiens] GI:4220890 Length = 443 Score = 27.5 bits (58), Expect = 7.8 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 191 LRRVFERCGEVGDIYIPRDRYKG 259 L + F CG++ IY+PRD +G Sbjct: 227 LEKHFASCGKITHIYVPRDFERG 249 >At4g19670.1 68417.m02889 zinc finger (C3HC4-type RING finger) family protein contains a Prosite:PS00518 Zinc finger, C3HC4 type (RING finger), signature and Pfam domain PF01485: IBR domain Length = 532 Score = 27.5 bits (58), Expect = 7.8 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -3 Query: 487 CGNGCGYDCASNYDGGNETWTCA 419 CG+ Y C + Y G +T TCA Sbjct: 398 CGHEFCYSCGAEYREGQQTCTCA 420 >At2g40800.1 68415.m05033 expressed protein Length = 377 Score = 27.5 bits (58), Expect = 7.8 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = -1 Query: 348 AVQHSSVHRVQGFFSITTLEKPYEGESSTFPLYR 247 + + S +V G F+ ++KP + SSTF YR Sbjct: 101 STKSSGFRKVDGSFARKVVDKPVKAVSSTFARYR 134 >At1g23860.2 68414.m03010 splicing factor RSZp21 (RSZP21) / 9G8-like SR protein (SRZ21) nearly identical to 9G8-like splicing factor SRZ21 [Arabidopsis thaliana] GI:3435096, RSZp21 protein [Arabidopsis thaliana] GI:2582643 Length = 187 Score = 27.5 bits (58), Expect = 7.8 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +1 Query: 250 VQRESRGFAFVRFFERRDAEEALDTMD 330 V R G+AF+ F + RDA +A+ +D Sbjct: 33 VARRPPGYAFLEFDDERDALDAISALD 59 >At1g23860.1 68414.m03009 splicing factor RSZp21 (RSZP21) / 9G8-like SR protein (SRZ21) nearly identical to 9G8-like splicing factor SRZ21 [Arabidopsis thaliana] GI:3435096, RSZp21 protein [Arabidopsis thaliana] GI:2582643 Length = 187 Score = 27.5 bits (58), Expect = 7.8 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +1 Query: 250 VQRESRGFAFVRFFERRDAEEALDTMD 330 V R G+AF+ F + RDA +A+ +D Sbjct: 33 VARRPPGYAFLEFDDERDALDAISALD 59 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,377,989 Number of Sequences: 28952 Number of extensions: 217823 Number of successful extensions: 840 Number of sequences better than 10.0: 149 Number of HSP's better than 10.0 without gapping: 737 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 838 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1285411824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -