BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060773.seq (647 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42595| Best HMM Match : Thioredoxin (HMM E-Value=0) 108 3e-24 SB_48081| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_35157| Best HMM Match : Thioredoxin (HMM E-Value=0) 76 2e-14 SB_30398| Best HMM Match : Thioredoxin (HMM E-Value=0) 72 5e-13 SB_3640| Best HMM Match : Thioredoxin (HMM E-Value=4.3e-33) 71 8e-13 SB_20276| Best HMM Match : Thioredoxin (HMM E-Value=9.8e-06) 69 2e-12 SB_17740| Best HMM Match : Thioredoxin (HMM E-Value=1.8e-27) 68 6e-12 SB_46929| Best HMM Match : Thioredoxin (HMM E-Value=0) 68 8e-12 SB_45978| Best HMM Match : Thioredoxin (HMM E-Value=4.19997e-41) 66 2e-11 SB_30498| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 8e-08 SB_30496| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 8e-08 SB_56064| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_218| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_55398| Best HMM Match : Thioredoxin (HMM E-Value=3.6e-21) 41 8e-04 SB_49513| Best HMM Match : Thioredoxin (HMM E-Value=1.8e-19) 41 8e-04 SB_27151| Best HMM Match : Thioredoxin (HMM E-Value=9.2e-32) 40 0.002 SB_14273| Best HMM Match : DUF1000 (HMM E-Value=0) 40 0.002 SB_44457| Best HMM Match : Thioredoxin (HMM E-Value=2.2e-07) 38 0.007 SB_38445| Best HMM Match : ERp29 (HMM E-Value=2.2e-19) 37 0.016 SB_59094| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.46 SB_42614| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.81 SB_38186| Best HMM Match : TrfA (HMM E-Value=1.4) 31 0.81 SB_23688| Best HMM Match : DUF402 (HMM E-Value=2.2) 30 1.4 SB_3213| Best HMM Match : zf-C2H2 (HMM E-Value=3.8e-40) 30 1.4 SB_50660| Best HMM Match : DUF479 (HMM E-Value=1.6) 30 1.4 SB_38415| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_13820| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_13271| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_2654| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_28181| Best HMM Match : RVP (HMM E-Value=0.00058) 29 2.5 SB_2701| Best HMM Match : Thioredoxin (HMM E-Value=4.8e-05) 29 2.5 SB_2655| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_25332| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_49078| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_45044| Best HMM Match : Thioredoxin (HMM E-Value=1.1) 29 3.3 SB_33545| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_22313| Best HMM Match : DB (HMM E-Value=4.7) 29 3.3 SB_24046| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_37449| Best HMM Match : DB (HMM E-Value=7.5) 28 5.7 SB_16564| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_40719| Best HMM Match : CUB (HMM E-Value=1.2e-07) 28 5.7 SB_42873| Best HMM Match : DB (HMM E-Value=7.1) 28 7.5 SB_25578| Best HMM Match : ShTK (HMM E-Value=2.4e-06) 28 7.5 SB_24641| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_34111| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 7.5 SB_32754| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_55587| Best HMM Match : Merozoite_SPAM (HMM E-Value=0.13) 27 9.9 SB_41245| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_24643| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_4085| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_1402| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_27739| Best HMM Match : DUF402 (HMM E-Value=9.2) 27 9.9 SB_17207| Best HMM Match : DB (HMM E-Value=5.1) 27 9.9 SB_943| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 >SB_42595| Best HMM Match : Thioredoxin (HMM E-Value=0) Length = 536 Score = 108 bits (260), Expect = 3e-24 Identities = 48/81 (59%), Positives = 63/81 (77%) Frame = +2 Query: 11 LGLALGDEVPTEENVLVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 190 + LA +E+ EE+VLVL++ NF+ ++ +++LVEFYAPWCGHCK+LAPEYAKAA +L Sbjct: 12 VSLAYSEEIKEEEDVLVLTEKNFDEAVAANKHVLVEFYAPWCGHCKALAPEYAKAAGQLK 71 Query: 191 EEESPIKLAKVDATQEQDLAE 253 E+S IKLAKVDAT E L E Sbjct: 72 SEKSEIKLAKVDATAETKLGE 92 Score = 105 bits (252), Expect = 3e-23 Identities = 50/113 (44%), Positives = 75/113 (66%) Frame = +1 Query: 256 YGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAEQAKELIDANTVI 435 + V+GYPT+KFF++G P +Y+GGR A +I+SWL KKTGPPA ++ +A+ K+ I V Sbjct: 94 FQVQGYPTIKFFKDGKPSEYAGGRTAPEIVSWLNKKTGPPAKDLATADAMKDFI-TKEVA 152 Query: 436 VFGFFSDQSSTRAKTFLSTAQVVDAKYLLLSAMRK*SRSWRLKMKMLCFSRTS 594 V GFF+D+ S AK FLS A +D + + + +S +L+ LCFSR++ Sbjct: 153 VVGFFTDKESDAAKAFLSAADGIDDVEFGIVSDKLLPQSTKLRETRLCFSRSA 205 Score = 55.6 bits (128), Expect = 3e-08 Identities = 30/77 (38%), Positives = 45/77 (58%), Gaps = 4/77 (5%) Frame = +2 Query: 23 LGDEVPTE---ENVLVLSKANFETVISTTEY-ILVEFYAPWCGHCKSLAPEYAKAATKLA 190 L E+P + + V VL NF+ V + + VEFYAPWCGHCK LAP + + K Sbjct: 373 LSAEIPEDWDSKPVKVLCGKNFDEVARNKDKNVFVEFYAPWCGHCKQLAPIWDQLGEKY- 431 Query: 191 EEESPIKLAKVDATQEQ 241 ++ + I +AK+D+T + Sbjct: 432 KDHADIVVAKMDSTANE 448 Score = 38.7 bits (86), Expect = 0.004 Identities = 18/45 (40%), Positives = 27/45 (60%), Gaps = 4/45 (8%) Frame = +1 Query: 262 VRGYPTLKFF-RNGSPIDYSGGRQADDIISWLK---KKTGPPAVE 384 V +PT+K+F + G +DY+GGR DD + +L+ K PA E Sbjct: 454 VHSFPTIKYFPKEGEAVDYNGGRTLDDFVKFLESGGKAGNEPAAE 498 >SB_48081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 645 Score = 98.7 bits (235), Expect = 4e-21 Identities = 44/75 (58%), Positives = 54/75 (72%) Frame = +2 Query: 29 DEVPTEENVLVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPI 208 DEV E++V VL+ NF+ VI ILVEFYAPWCGHCKSLAPEYAKAA K+ + P+ Sbjct: 55 DEVKEEDDVSVLNSKNFDRVIEENNIILVEFYAPWCGHCKSLAPEYAKAAKKMKLNDPPV 114 Query: 209 KLAKVDATQEQDLAE 253 AK+DAT D+A+ Sbjct: 115 PFAKMDATVASDIAQ 129 Score = 85.8 bits (203), Expect = 3e-17 Identities = 39/72 (54%), Positives = 49/72 (68%) Frame = +2 Query: 38 PTEENVLVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLA 217 P L L+K NF V++ +LVEF+APWCGHCK LAPEY KAA +L + + PI LA Sbjct: 173 PPPVAALTLTKENFTEVVNRESLMLVEFFAPWCGHCKQLAPEYEKAAQELQKHDPPIPLA 232 Query: 218 KVDATQEQDLAE 253 VDAT E +LA+ Sbjct: 233 IVDATIESELAQ 244 Score = 53.6 bits (123), Expect = 1e-07 Identities = 26/88 (29%), Positives = 46/88 (52%), Gaps = 1/88 (1%) Frame = +1 Query: 256 YGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAEQAKELI-DANTV 432 Y V+GYPTLK FR G +Y G R I S+++ + GP + ++S + ++ + + + V Sbjct: 246 YEVQGYPTLKVFRKGKATEYKGQRDQYGIASYMRSQVGPSSRILSSLKAVQDFMKEKDDV 305 Query: 433 IVFGFFSDQSSTRAKTFLSTAQVVDAKY 516 + GFF + +++L V Y Sbjct: 306 TIMGFFDGEDDKMLESYLEANNDVRDDY 333 Score = 51.2 bits (117), Expect = 7e-07 Identities = 24/72 (33%), Positives = 43/72 (59%), Gaps = 6/72 (8%) Frame = +1 Query: 256 YGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG-----PPAVEVT-SAEQAKELI 417 + V GYPTLK FR G+P +Y G R+ I+ ++KK++ PP +T + E E++ Sbjct: 131 FDVSGYPTLKIFRKGTPYEYEGPREESGIVEYMKKQSDPNWKPPPVAALTLTKENFTEVV 190 Query: 418 DANTVIVFGFFS 453 + ++++ FF+ Sbjct: 191 NRESLMLVEFFA 202 Score = 41.9 bits (94), Expect = 4e-04 Identities = 26/75 (34%), Positives = 39/75 (52%) Frame = +2 Query: 44 EENVLVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKV 223 E +V+ K E V + +L+EFYAPWCG +L P + K +++ I +AK+ Sbjct: 525 EPVTVVVGKTFDEIVNDPKKDVLIEFYAPWCG--IALEPTFKKLGKHFRNDKN-IVIAKI 581 Query: 224 DATQEQDLAETTVCE 268 DAT D+ T E Sbjct: 582 DAT-ANDVPSTYAVE 595 Score = 33.5 bits (73), Expect = 0.15 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 3/55 (5%) Frame = +1 Query: 256 YGVRGYPTLKFFRNG---SPIDYSGGRQADDIISWLKKKTGPPAVEVTSAEQAKE 411 Y V G+PT+ F + +PI + GGR+ D+I ++++K A S E+AK+ Sbjct: 592 YAVEGFPTIYFATSKDKKNPIKFDGGRELKDLIKFVEEK----ATVSLSKEKAKD 642 >SB_35157| Best HMM Match : Thioredoxin (HMM E-Value=0) Length = 1056 Score = 76.2 bits (179), Expect = 2e-14 Identities = 32/62 (51%), Positives = 45/62 (72%) Frame = +2 Query: 50 NVLVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDA 229 +VL L +NF++ ++ + +LVEF+APWCGHCK LAPEY AA L + + P+ LAKVD Sbjct: 539 DVLDLGDSNFKSGVAGKDIMLVEFFAPWCGHCKRLAPEYETAAEALKKNDPPVPLAKVDC 598 Query: 230 TQ 235 T+ Sbjct: 599 TE 600 Score = 67.7 bits (158), Expect = 8e-12 Identities = 37/82 (45%), Positives = 48/82 (58%), Gaps = 2/82 (2%) Frame = +1 Query: 256 YGVRGYPTLKFFRNGSPI-DYSGGRQADDIISWLKKKTGPPAVEVTSAEQ-AKELIDANT 429 YGV GYPTLK FRNG DY G R + II ++KK+ GP +VE+ S + K+L DA + Sbjct: 609 YGVSGYPTLKIFRNGEMSKDYDGPRDSSGIIRYMKKQAGPSSVEIKSVDHLEKKLDDAES 668 Query: 430 VIVFGFFSDQSSTRAKTFLSTA 495 +V GF D F+ TA Sbjct: 669 NVVVGFL-DGDDDLKNAFMRTA 689 Score = 65.7 bits (153), Expect = 3e-11 Identities = 33/93 (35%), Positives = 56/93 (60%), Gaps = 1/93 (1%) Frame = +2 Query: 53 VLVLSKANFETVIST-TEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDA 229 V V+ NF+ +++ T+ +L+EFYAPWCGHCKSL P+Y + KL ++ I +AK+DA Sbjct: 864 VKVVVGENFKEIVNDPTKDVLIEFYAPWCGHCKSLEPKYNELGEKL-QDVKDIVIAKMDA 922 Query: 230 TQEQDLAETTVCEDTRLSSSSGMAVLLTIQVVV 328 T D + + S G+ +++ I +++ Sbjct: 923 T-ANDAPPNFSVQGIIIISIIGIIIIVIIMIII 954 Score = 31.9 bits (69), Expect = 0.46 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = +1 Query: 256 YGVRGYPTLKFFRNGSPI-DYSGGRQADDIISWLKKKTG 369 +G+ +PTLK FR G P DY+G + + S++ + G Sbjct: 448 FGIHQWPTLKLFRYGQPWGDYTGPQDTASLESYIHDQLG 486 >SB_30398| Best HMM Match : Thioredoxin (HMM E-Value=0) Length = 295 Score = 71.7 bits (168), Expect = 5e-13 Identities = 32/69 (46%), Positives = 47/69 (68%) Frame = +2 Query: 41 TEENVLVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAK 220 T+ V+ L+K NF+ V++ ++ LVEFYAPWCGHCK LAP Y + + + S + +AK Sbjct: 20 TQGKVIDLTKDNFDEVVNGEKFALVEFYAPWCGHCKQLAPTYEQLG-EAYTQSSDVIIAK 78 Query: 221 VDATQEQDL 247 VDA ++DL Sbjct: 79 VDADGDRDL 87 Score = 46.4 bits (105), Expect = 2e-05 Identities = 22/45 (48%), Positives = 33/45 (73%), Gaps = 2/45 (4%) Frame = +1 Query: 241 GSRRDYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKKKTG 369 GSR D V+G+PT+K+F GS P +Y+GGR +D I ++++KTG Sbjct: 88 GSRFD--VKGFPTIKYFPKGSTTPEEYNGGRDINDFIKFIEEKTG 130 >SB_3640| Best HMM Match : Thioredoxin (HMM E-Value=4.3e-33) Length = 386 Score = 70.9 bits (166), Expect = 8e-13 Identities = 36/78 (46%), Positives = 46/78 (58%), Gaps = 3/78 (3%) Frame = +2 Query: 29 DEVP---TEENVLVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEE 199 DE P T V+ L F+ ++ +LV FYAPWCGHCK++ PEY AA L E+E Sbjct: 73 DEKPWSDTPSEVVHLRDDMFDDFVAKNPSVLVMFYAPWCGHCKAMKPEYVDAAQTLKEQE 132 Query: 200 SPIKLAKVDATQEQDLAE 253 P LA VDAT+E L + Sbjct: 133 IPGVLAAVDATKEAALGK 150 Score = 54.8 bits (126), Expect = 6e-08 Identities = 29/83 (34%), Positives = 44/83 (53%) Frame = +2 Query: 32 EVPTEENVLVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIK 211 E+P+E V LS F++ + +++LV FYAPWCGHCK PE AA + K Sbjct: 192 EIPSE--VYHLSDTTFKSFVKKKKHVLVMFYAPWCGHCKKAKPELMSAA-----KHHKDK 244 Query: 212 LAKVDATQEQDLAETTVCEDTRL 280 + + ++ D + T+C RL Sbjct: 245 NKRALSLRDFDFSNDTLCNRRRL 267 Score = 33.1 bits (72), Expect = 0.20 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +2 Query: 107 ILVEFYAPWCGHCKSLAPEYAKAATKLAEE 196 +++ Y CG+CK PE+A AAT+ +E Sbjct: 2 VVIVLYIAGCGYCKRFKPEFAAAATEHKDE 31 Score = 27.5 bits (58), Expect = 9.9 Identities = 18/45 (40%), Positives = 25/45 (55%) Frame = +2 Query: 50 NVLVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEYAKAATK 184 NV L++ F+ + T + ILV FYAP C K A +Y +A K Sbjct: 335 NVQHLTQDTFDEALKTFDSILVMFYAP-CMKGK-FAFDYERARAK 377 >SB_20276| Best HMM Match : Thioredoxin (HMM E-Value=9.8e-06) Length = 70 Score = 69.3 bits (162), Expect = 2e-12 Identities = 29/57 (50%), Positives = 41/57 (71%) Frame = +2 Query: 50 NVLVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAK 220 +VL L +NF++ ++ + +LVEF+APWCGHCK LAPEY AA L + + P+ LAK Sbjct: 14 DVLDLGDSNFKSGVAGKDIMLVEFFAPWCGHCKRLAPEYETAAEALKKNDPPVPLAK 70 >SB_17740| Best HMM Match : Thioredoxin (HMM E-Value=1.8e-27) Length = 472 Score = 68.1 bits (159), Expect = 6e-12 Identities = 33/86 (38%), Positives = 51/86 (59%), Gaps = 2/86 (2%) Frame = +2 Query: 17 LALGDEVPTEENVLV-LSKANFETVISTTEYILVEFYAPWCGHCKSLAPEYAKAATK-LA 190 L D VP +E L+ L +NFE + +++LV+FYAPWC HCK +AP+Y A + L Sbjct: 123 LMASDGVPDDEPTLLELDDSNFEPAVQKHKFVLVDFYAPWCFHCKKMAPDYKDVAKELLI 182 Query: 191 EEESPIKLAKVDATQEQDLAETTVCE 268 + ++LAKVD + ++A C+ Sbjct: 183 LSHNSVRLAKVDCS-ANNMATKKTCK 207 Score = 60.5 bits (140), Expect = 1e-09 Identities = 26/62 (41%), Positives = 36/62 (58%) Frame = +2 Query: 38 PTEENVLVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLA 217 P VL L+ NF I EY+LV+FYAPWC C+ L+P + AA +L + ++ A Sbjct: 48 PASPAVLNLNDQNFNETIKKNEYVLVDFYAPWCSDCQRLSPLFDTAALQLRDNNPSLRFA 107 Query: 218 KV 223 KV Sbjct: 108 KV 109 >SB_46929| Best HMM Match : Thioredoxin (HMM E-Value=0) Length = 362 Score = 67.7 bits (158), Expect = 8e-12 Identities = 32/64 (50%), Positives = 48/64 (75%), Gaps = 1/64 (1%) Frame = +2 Query: 44 EENVLVLSKANFET-VISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAK 220 +E+V+ L+ NFE V+++ + LVEF+APWCGHC+ LAPE+AKAAT+L + +K+ Sbjct: 78 KEDVVELTDTNFEKEVLNSKDLWLVEFFAPWCGHCQRLAPEWAKAATEL---KGKVKVGA 134 Query: 221 VDAT 232 +DAT Sbjct: 135 LDAT 138 Score = 46.0 bits (104), Expect = 3e-05 Identities = 35/106 (33%), Positives = 49/106 (46%), Gaps = 13/106 (12%) Frame = +1 Query: 238 TGSRRDYGVRGYPTLKFFRNG-----SPIDYSGGRQADDIISWLKKKTG-----PPAVEV 387 T SR Y V+GYPT+K F G S DY GGR A DII + K P ++ Sbjct: 143 TASR--YQVQGYPTIKVFAAGIKNSHSVEDYQGGRTASDIIQYALDKAADSIEPPEVIQA 200 Query: 388 TSAEQAKELIDANTVIVFGFFS---DQSSTRAKTFLSTAQVVDAKY 516 S E KE + + + V F D ++ T+L+ + + KY Sbjct: 201 ISNEVLKEGCNEHPICVIAFLPHILDSGASGRNTYLANLKELGEKY 246 Score = 34.7 bits (76), Expect = 0.066 Identities = 15/32 (46%), Positives = 20/32 (62%), Gaps = 2/32 (6%) Frame = +1 Query: 256 YGVRGYPTLKFF--RNGSPIDYSGGRQADDII 345 Y +RG+PT+K F SP DY+G R A I+ Sbjct: 11 YNIRGFPTIKIFGANKNSPQDYNGQRTAQGIV 42 >SB_45978| Best HMM Match : Thioredoxin (HMM E-Value=4.19997e-41) Length = 271 Score = 66.1 bits (154), Expect = 2e-11 Identities = 29/80 (36%), Positives = 46/80 (57%) Frame = +2 Query: 14 GLALGDEVPTEENVLVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 193 G D + V+ L+ + + I + E +LV ++APWCGHC + P Y KAA L + Sbjct: 39 GYPTSDWSKDDSKVVFLTDESHDEFIKSHENVLVMYFAPWCGHCNEMKPNYYKAAQVLHD 98 Query: 194 EESPIKLAKVDATQEQDLAE 253 E++ LA VD T+ +D+A+ Sbjct: 99 EDANCNLAAVDCTKHKDVAK 118 Score = 62.1 bits (144), Expect = 4e-10 Identities = 29/72 (40%), Positives = 47/72 (65%), Gaps = 2/72 (2%) Frame = +2 Query: 44 EENVLV--LSKANFETVISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLA 217 E++ LV L ++F ++ TE++LV FYAPWCGHCK+ P+Y KAA ++ + + A Sbjct: 144 EDSSLVKQLDGSDFWGYLNNTEHVLVMFYAPWCGHCKNAKPKYEKAAETFKDQPNRV-FA 202 Query: 218 KVDATQEQDLAE 253 K+D T+ D+ + Sbjct: 203 KLDCTKFGDVCD 214 Score = 33.9 bits (74), Expect = 0.11 Identities = 14/38 (36%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = +1 Query: 262 VRGYPTLKFFRNGS-PIDYSGGRQADDIISWLKKKTGP 372 V GYPTL+++ G ++Y G R +D+IS++++ P Sbjct: 218 VNGYPTLRYYLYGKFVVEYDGDRVTEDLISFMEEPPLP 255 >SB_30498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 564 Score = 54.4 bits (125), Expect = 8e-08 Identities = 27/73 (36%), Positives = 42/73 (57%) Frame = +2 Query: 62 LSKANFETVISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQ 241 L+ NF+ +I + +LV+FYAPWC HC+ L P+ AA LA + + AKVD T Sbjct: 25 LNAQNFDQMIREKDIMLVDFYAPWCHHCQELLPQLEGAANALA-AKGLFQFAKVDCT--- 80 Query: 242 DLAETTVCEDTRL 280 D +C++ ++ Sbjct: 81 DPRSKVLCDNFKI 93 >SB_30496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 488 Score = 54.4 bits (125), Expect = 8e-08 Identities = 26/72 (36%), Positives = 38/72 (52%) Frame = +2 Query: 44 EENVLVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKV 223 E + L+ +F+ + E +LV+FYAPWC C +L P+Y KAA LA+E K Sbjct: 21 ENPIFELTDQDFDNFLKDKEVMLVDFYAPWCSDCDNLRPKYEKAARDLAKEH---KFVMA 77 Query: 224 DATQEQDLAETT 259 A + +TT Sbjct: 78 KALMNTNSTQTT 89 >SB_56064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 711 Score = 48.4 bits (110), Expect = 5e-06 Identities = 24/63 (38%), Positives = 37/63 (58%) Frame = +2 Query: 59 VLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQE 238 V SK F V+++ + +V+FYAPWCG C AP+Y + A L + ++ AKV+ Q+ Sbjct: 438 VNSKNFFTDVLASEDAWVVDFYAPWCGPCMRFAPKYEQLAKML---KGKVRAAKVNCEQD 494 Query: 239 QDL 247 L Sbjct: 495 YGL 497 Score = 46.4 bits (105), Expect = 2e-05 Identities = 27/78 (34%), Positives = 36/78 (46%), Gaps = 1/78 (1%) Frame = +2 Query: 17 LALGDEVPTEENVLVLSKANF-ETVISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 193 +AL + NV L +F +V S + V+F+APWC C L PEY KAA Sbjct: 274 IALFAKESVSSNVHALGPEDFPSSVTSPSRPFFVDFFAPWCPPCMRLLPEYRKAARSFVG 333 Query: 194 EESPIKLAKVDATQEQDL 247 + P+ VD T L Sbjct: 334 K--PVGFGTVDCTVHSQL 349 Score = 30.3 bits (65), Expect = 1.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 256 YGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLK 357 Y +R YPT + N P + G A DII +++ Sbjct: 353 YNIRSYPTTILYNNSQPHQFIGHHNALDIIEFVE 386 >SB_218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 45.6 bits (103), Expect = 4e-05 Identities = 23/73 (31%), Positives = 41/73 (56%), Gaps = 2/73 (2%) Frame = +2 Query: 68 KANFETVISTTE--YILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQ 241 +A F +VI+ T+ ++++FYA WCG C+ + P++ K A EE + AK+D E Sbjct: 18 RAEFNSVINNTKDKLVVIDFYAEWCGPCRQIKPKFKKMA---LEEFKDVFFAKID-VDEL 73 Query: 242 DLAETTVCEDTRL 280 +L + + +L Sbjct: 74 ELEKLVGANEVKL 86 >SB_55398| Best HMM Match : Thioredoxin (HMM E-Value=3.6e-21) Length = 186 Score = 41.1 bits (92), Expect = 8e-04 Identities = 21/62 (33%), Positives = 36/62 (58%) Frame = +2 Query: 41 TEENVLVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAK 220 +E V +L+K F+ I + V+FYAPWC HC LAP + + A ++ + I ++K Sbjct: 88 SEAGVHILTKNTFDKHIELGLHF-VKFYAPWCIHCIKLAPIWERLAEDF-KDNADITISK 145 Query: 221 VD 226 ++ Sbjct: 146 IN 147 Score = 30.3 bits (65), Expect = 1.4 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +1 Query: 262 VRGYPTLKFFRNGSPIDYSGGRQADDIISWLKK 360 +R YPT+K + +G Y+G R A+D+ ++ K Sbjct: 38 IRAYPTMKLYYDGDIKRYTGRRNAEDMKVFVDK 70 Score = 29.5 bits (63), Expect = 2.5 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +1 Query: 262 VRGYPTLKFFRNG-SPIDYSGGRQADDIISWL 354 + GYPTL F++G +YSG R D + ++ Sbjct: 146 INGYPTLMLFKDGVQKKEYSGNRDLDSLYRFI 177 >SB_49513| Best HMM Match : Thioredoxin (HMM E-Value=1.8e-19) Length = 975 Score = 41.1 bits (92), Expect = 8e-04 Identities = 17/52 (32%), Positives = 30/52 (57%) Frame = +2 Query: 80 ETVISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQ 235 + VI+ + +L+ FY PWCG C + AP A + ++ S + + ++DA Q Sbjct: 529 DIVINNDQDVLLVFYTPWCGMCINFAP-VLLAVARFFQDISQVSVTRIDADQ 579 >SB_27151| Best HMM Match : Thioredoxin (HMM E-Value=9.2e-32) Length = 456 Score = 39.9 bits (89), Expect = 0.002 Identities = 23/72 (31%), Positives = 39/72 (54%), Gaps = 3/72 (4%) Frame = +2 Query: 50 NVLVLSKANFETVI---STTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAK 220 NV+V+ +F +V + + ++++F A WCG CKS+AP + + K + + K Sbjct: 9 NVIVVEDDSFFSVEIERAGSRLVVIDFTATWCGPCKSIAPVFTNLSMKFMD----VVFLK 64 Query: 221 VDATQEQDLAET 256 VD Q Q AE+ Sbjct: 65 VDVDQCQLTAES 76 >SB_14273| Best HMM Match : DUF1000 (HMM E-Value=0) Length = 308 Score = 39.5 bits (88), Expect = 0.002 Identities = 25/70 (35%), Positives = 37/70 (52%), Gaps = 3/70 (4%) Frame = +2 Query: 50 NVLVL---SKANFETVISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAK 220 NV VL S+ E + T+ ++ +F A WCG CKS+AP Y + L+E+ K Sbjct: 8 NVKVLELDSQFTAELTNAGTKLVVADFTASWCGPCKSIAPVY----SGLSEKYKQAVFLK 63 Query: 221 VDATQEQDLA 250 +D Q+LA Sbjct: 64 IDVDVCQELA 73 >SB_44457| Best HMM Match : Thioredoxin (HMM E-Value=2.2e-07) Length = 438 Score = 37.9 bits (84), Expect = 0.007 Identities = 16/50 (32%), Positives = 28/50 (56%) Frame = +2 Query: 77 FETVISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVD 226 F+ + E ++F A WCG C+ + P++ ++A+E +K AKVD Sbjct: 4 FDKFLKDNEVAAIDFTATWCGPCRMIGPKF----EEMAKEFKGVKCAKVD 49 >SB_38445| Best HMM Match : ERp29 (HMM E-Value=2.2e-19) Length = 335 Score = 36.7 bits (81), Expect = 0.016 Identities = 14/68 (20%), Positives = 37/68 (54%) Frame = +2 Query: 47 ENVLVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVD 226 + ++ + N + + ++++ + FYAPW HC+ + + + A + A+ + I + K + Sbjct: 26 KKIVEFTNENVDEYVDGSKFVFIFFYAPWDDHCQRILQIFDQVADEFADRDD-IVVGKSN 84 Query: 227 ATQEQDLA 250 A ++ +A Sbjct: 85 AYEDVKIA 92 >SB_59094| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 335 Score = 31.9 bits (69), Expect = 0.46 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = +1 Query: 256 YGVRGYPTLKFFRNGSPI-DYSGGRQADDIISWLKKKTG 369 +G+ +PTLK FR G P DY+G + + S++ + G Sbjct: 251 FGIHQWPTLKLFRYGQPWGDYTGPQDTASLESYIHDQLG 289 >SB_42614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 581 Score = 31.1 bits (67), Expect = 0.81 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = -1 Query: 239 VLELRQLSLV**EILLQPALWLPWRIPAPETCSGRTME 126 + E RQLS+ E+L P LPW + AP+ C +T + Sbjct: 158 IAEARQLSMK--EVLFHPLGPLPWSLAAPDGCLKKTQK 193 >SB_38186| Best HMM Match : TrfA (HMM E-Value=1.4) Length = 429 Score = 31.1 bits (67), Expect = 0.81 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = -1 Query: 239 VLELRQLSLV**EILLQPALWLPWRIPAPETCSGRTME 126 + E RQLS+ E+L P LPW + AP+ C +T + Sbjct: 148 IAEARQLSMK--EVLFHPLGPLPWSLAAPDGCLKKTQK 183 >SB_23688| Best HMM Match : DUF402 (HMM E-Value=2.2) Length = 230 Score = 30.3 bits (65), Expect = 1.4 Identities = 22/66 (33%), Positives = 33/66 (50%), Gaps = 1/66 (1%) Frame = +2 Query: 92 STTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCE- 268 S +Y V+ PW G + +Y A TKL EES ++ VD+ + +E C+ Sbjct: 139 SELQYCDVDTKLPW-GKSEL---QYCDADTKLLSEESELQYCDVDSKLLSEESELQYCDA 194 Query: 269 DTRLSS 286 DT+L S Sbjct: 195 DTKLLS 200 Score = 28.3 bits (60), Expect = 5.7 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +2 Query: 161 EYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCEDTR 277 +Y A TKL EES ++ VD + +E C+ TR Sbjct: 190 QYCDADTKLLSEESELQYWDVDTKLLSEASELQYCDVTR 228 >SB_3213| Best HMM Match : zf-C2H2 (HMM E-Value=3.8e-40) Length = 595 Score = 30.3 bits (65), Expect = 1.4 Identities = 16/40 (40%), Positives = 20/40 (50%), Gaps = 5/40 (12%) Frame = +3 Query: 399 TG*RTYRCQYCYCIWFLFGPELNQSQNF-----PFNCSSC 503 TG R YRC YC + F + +L Q N P+ C SC Sbjct: 486 TGARPYRCPYCLKL-FRYSGDLKQHINIHTGQRPYQCESC 524 >SB_50660| Best HMM Match : DUF479 (HMM E-Value=1.6) Length = 730 Score = 30.3 bits (65), Expect = 1.4 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = -1 Query: 239 VLELRQLSLV**EILLQPALWLPWRIPAPETCSGRTME 126 + E RQLS+ E+L P LPW + AP+ C +T + Sbjct: 628 IAEARQLSMK--EVLSHPLGPLPWSLAAPDGCLKKTQK 663 >SB_38415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 837 Score = 30.3 bits (65), Expect = 1.4 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = -1 Query: 239 VLELRQLSLV**EILLQPALWLPWRIPAPETCSGRTME 126 + E RQLS+ E+L P LPW + AP+ C +T + Sbjct: 156 IAEARQLSIK--EVLSHPLGPLPWSLAAPDGCLKKTQK 191 >SB_13820| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 646 Score = 29.9 bits (64), Expect = 1.9 Identities = 22/66 (33%), Positives = 32/66 (48%), Gaps = 1/66 (1%) Frame = +2 Query: 92 STTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCE- 268 S +Y V+ PW G + +Y A TKL EES ++ VD + +E C+ Sbjct: 155 SELQYCDVDTKLPW-GKSEL---QYCDADTKLLSEESELQYCDVDTKLFSEESELKYCDV 210 Query: 269 DTRLSS 286 DT+L S Sbjct: 211 DTKLLS 216 Score = 29.1 bits (62), Expect = 3.3 Identities = 23/85 (27%), Positives = 37/85 (43%), Gaps = 6/85 (7%) Frame = +2 Query: 56 LVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPE-----YAKAATKLAEEESPIKLAK 220 L+L ++ + T+ +L E +C L E Y TKL EES ++ Sbjct: 518 LLLEESELQYCDVDTKLLLEESELQYCDVDTKLISEESELQYCDVDTKLLSEESELQYCD 577 Query: 221 VDATQEQDLAETTVCE-DTRLSSSS 292 VD + +E C+ DT+L S + Sbjct: 578 VDTKLISEASELQYCDVDTKLLSEA 602 Score = 28.7 bits (61), Expect = 4.3 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +2 Query: 161 EYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCE-DTRLSSSS 292 +Y A TKL EES ++ VD + +E C+ DT+L S + Sbjct: 382 QYCDADTKLFSEESELQYWDVDTKLLSEASELQYCDVDTKLLSEA 426 Score = 27.9 bits (59), Expect = 7.5 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +2 Query: 161 EYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCE-DTRL 280 +Y TKL EES +K VD + +E C+ DT+L Sbjct: 190 QYCDVDTKLFSEESELKYCDVDTKLLSEESELQYCDVDTKL 230 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 161 EYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCE-DTRLSS 286 +Y TKL EES ++ VD + +E C+ DT+L S Sbjct: 254 QYCDVDTKLLSEESELQYCDVDTKLLSEESELQYCDVDTKLFS 296 >SB_13271| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 39 Score = 29.9 bits (64), Expect = 1.9 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = +2 Query: 50 NVLVLSKANFETVISTTEYILVEFYA 127 NV++L + NF+ VI+ + + V FYA Sbjct: 12 NVVILDEGNFDKVIAENKLVFVNFYA 37 >SB_2654| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 29.9 bits (64), Expect = 1.9 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = +2 Query: 125 APWCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLA 250 A WC CK L P + +AE++ + LAKVD +LA Sbjct: 46 ACWCNPCKVLTP---RLDAIIAEQDGKVDLAKVDIDVMGELA 84 >SB_28181| Best HMM Match : RVP (HMM E-Value=0.00058) Length = 664 Score = 29.5 bits (63), Expect = 2.5 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +2 Query: 113 VEFYAPWCGHCKSLAPEYAKAATKL 187 V FYAPWCG + E+ AA+ L Sbjct: 457 VFFYAPWCGQSRRAVEEFNIAASLL 481 >SB_2701| Best HMM Match : Thioredoxin (HMM E-Value=4.8e-05) Length = 215 Score = 29.5 bits (63), Expect = 2.5 Identities = 10/29 (34%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Frame = +2 Query: 74 NFETVISTTEYIL--VEFYAPWCGHCKSL 154 +F+ ++S++ +L V F+APW HC + Sbjct: 11 DFDRILSSSSNVLAVVHFFAPWAPHCNQM 39 >SB_2655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 29.5 bits (63), Expect = 2.5 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +2 Query: 131 WCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLA 250 WC CK L P + +AE++ + LAKVD +LA Sbjct: 2 WCNPCKVLTP---RLDAIIAEQDGKVDLAKVDIDVMGELA 38 >SB_25332| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 41 Score = 29.5 bits (63), Expect = 2.5 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +1 Query: 262 VRGYPTLKFFRNG-SPIDYSGGRQADDIISWL 354 + GYPTL F++G +YSG R D + ++ Sbjct: 1 INGYPTLMLFKDGVQKKEYSGNRDLDSLYRFI 32 >SB_49078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 29.1 bits (62), Expect = 3.3 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +2 Query: 161 EYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCE-DTRLSS 286 +Y A TKL EES ++ VD + +E C+ DT+L S Sbjct: 16 QYCDADTKLLSEESELQYCDVDTKLLSEESELQYCDVDTKLLS 58 Score = 27.9 bits (59), Expect = 7.5 Identities = 15/45 (33%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +2 Query: 161 EYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCE-DTRLSSSS 292 +Y TKL EES ++ VD + +E C+ DT+L S + Sbjct: 32 QYCDVDTKLLSEESELQYCDVDTKLLSEESELQYCDVDTKLLSEA 76 Score = 27.9 bits (59), Expect = 7.5 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +2 Query: 161 EYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCEDTR 277 +Y TKL EES ++ VD + +E C+ TR Sbjct: 48 QYCDVDTKLLSEESELQYCDVDTKLLSEASELQYCDVTR 86 >SB_45044| Best HMM Match : Thioredoxin (HMM E-Value=1.1) Length = 213 Score = 29.1 bits (62), Expect = 3.3 Identities = 11/38 (28%), Positives = 22/38 (57%) Frame = +2 Query: 131 WCGHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQD 244 WCG CK+L P++A+ + ++A+ + + +E D Sbjct: 8 WCGACKALRPKFAE-SKEVAQLSKKFVMVHLQENEEPD 44 >SB_33545| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 897 Score = 29.1 bits (62), Expect = 3.3 Identities = 23/85 (27%), Positives = 37/85 (43%), Gaps = 6/85 (7%) Frame = +2 Query: 56 LVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPE-----YAKAATKLAEEESPIKLAK 220 L+L ++ + T+ +L E +C L E Y TKL EES ++ Sbjct: 769 LLLEESELQYCDVDTKLLLEESELQYCDVDTKLISEESELQYCDVDTKLLSEESELQYCD 828 Query: 221 VDATQEQDLAETTVCE-DTRLSSSS 292 VD + +E C+ DT+L S + Sbjct: 829 VDTKLISEASELQYCDVDTKLLSEA 853 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 161 EYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCE-DTRLSS 286 +Y TKL EES ++ VD + +E C+ DT+L S Sbjct: 262 QYCDVDTKLLSEESELQYCDVDTKLLSEESELQYCDVDTKLLS 304 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 161 EYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCE-DTRLSS 286 +Y TKL EES ++ VD + +E C+ DT+L S Sbjct: 278 QYCDVDTKLLSEESELQYCDVDTKLLSEESELQYCDVDTKLLS 320 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 161 EYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCE-DTRLSS 286 +Y TKL EES ++ VD + +E C+ DT+L S Sbjct: 294 QYCDVDTKLLSEESELQYCDVDTKLLSEESELQYCDVDTKLLS 336 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 161 EYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCE-DTRLSS 286 +Y TKL EES ++ VD + +E C+ DT+L S Sbjct: 633 QYCDVDTKLLSEESELQYCDVDTKLLSEESELQYCDVDTKLLS 675 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 161 EYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCE-DTRLSS 286 +Y TKL EES ++ VD + +E C+ DT+L S Sbjct: 649 QYCDVDTKLLSEESELQYCDVDTKLLSEESELQYCDVDTKLLS 691 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 161 EYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCE-DTRLSS 286 +Y TKL EES ++ VD + +E C+ DT+L S Sbjct: 665 QYCDVDTKLLSEESELQYCDVDTKLLSEESELQYCDVDTKLLS 707 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 161 EYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCE-DTRLSS 286 +Y TKL EES ++ VD + +E C+ DT+L S Sbjct: 681 QYCDVDTKLLSEESELQYCDVDTKLLSEESELQYCDVDTKLLS 723 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 161 EYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCE-DTRLSS 286 +Y TKL EES ++ VD + +E C+ DT+L S Sbjct: 697 QYCDVDTKLLSEESELQYCDVDTKLLSEESELQYCDVDTKLLS 739 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 161 EYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCE-DTRLSS 286 +Y TKL EES ++ VD + +E C+ DT+L S Sbjct: 713 QYCDVDTKLLSEESELQYCDVDTKLLSEESELQYCDVDTKLLS 755 >SB_22313| Best HMM Match : DB (HMM E-Value=4.7) Length = 308 Score = 29.1 bits (62), Expect = 3.3 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +2 Query: 161 EYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCE-DTRLSS 286 +Y A TKL EES ++ VD + +E C+ DT+L S Sbjct: 188 QYCDADTKLLSEESELQYCDVDTKLLSEESELQYCDVDTKLLS 230 Score = 28.3 bits (60), Expect = 5.7 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +2 Query: 161 EYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCEDTR 277 +Y A TKL EES ++ VD + +E C+ TR Sbjct: 268 QYCDADTKLLSEESELQYWDVDTKLLSEASELQYCDVTR 306 >SB_24046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2848 Score = 28.7 bits (61), Expect = 4.3 Identities = 16/30 (53%), Positives = 21/30 (70%) Frame = +3 Query: 537 KVIKELEAEDEDVVLFKNFEEKRVKYEDEE 626 +V KELEAE E L K EE+R++ E+EE Sbjct: 1423 EVQKELEAEMEMERLQKENEEERLRKEEEE 1452 >SB_37449| Best HMM Match : DB (HMM E-Value=7.5) Length = 240 Score = 28.3 bits (60), Expect = 5.7 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 161 EYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCE-DTRLSS 286 +Y TKL EES ++ VD + +E C+ DT+L S Sbjct: 16 QYCDVDTKLLSEESELQYCDVDTKLLSEASELQYCDVDTKLLS 58 >SB_16564| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 288 Score = 28.3 bits (60), Expect = 5.7 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 1/63 (1%) Frame = +2 Query: 161 EYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCE-DTRLSSSSGMAVLLTIQVVVKLM 337 +Y TKL EES ++ VD + +E C+ DT+L S + L V +KL+ Sbjct: 192 QYCDVDTKLLSEESELQYCDVDTRLLSEESELQYCDLDTKLLSEE--SELQYCDVDIKLL 249 Query: 338 TSS 346 + + Sbjct: 250 SEA 252 Score = 27.9 bits (59), Expect = 7.5 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +2 Query: 161 EYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCE-DTRLSS 286 +Y+ TKL EES ++ VD + +E C+ DTRL S Sbjct: 176 QYSDVDTKLLLEESELQYCDVDTKLLSEESELQYCDVDTRLLS 218 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 161 EYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCE-DTRLSS 286 +Y TKL EES ++ VD + +E C+ DT+L S Sbjct: 224 QYCDLDTKLLSEESELQYCDVDIKLLSEASELQYCDVDTKLLS 266 >SB_40719| Best HMM Match : CUB (HMM E-Value=1.2e-07) Length = 272 Score = 28.3 bits (60), Expect = 5.7 Identities = 17/63 (26%), Positives = 29/63 (46%) Frame = +1 Query: 292 RNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAEQAKELIDANTVIVFGFFSDQSSTR 471 R+ +P+ +G DDI + L + PP E A E+ A+ +V G + ++ T Sbjct: 173 RDLTPLPGNGVPTLDDIPAVLIAEDRPPTYSEAVEEDALEMTAADVAVVHGGHTGETDTE 232 Query: 472 AKT 480 T Sbjct: 233 PPT 235 >SB_42873| Best HMM Match : DB (HMM E-Value=7.1) Length = 321 Score = 27.9 bits (59), Expect = 7.5 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 1/63 (1%) Frame = +2 Query: 161 EYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCE-DTRLSSSSGMAVLLTIQVVVKLM 337 +Y TKL EES ++ VD + +E C+ DT+L S + L V +KL+ Sbjct: 96 QYCDVDTKLLSEESELQYCDVDIKLLSEESELQYCDVDTKLLSEE--SELQYCDVDIKLL 153 Query: 338 TSS 346 + + Sbjct: 154 SEA 156 Score = 27.9 bits (59), Expect = 7.5 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 161 EYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCE-DTRLSS 286 +Y TKL EES ++ VD + +E C+ DT+L S Sbjct: 128 QYCDVDTKLLSEESELQYCDVDIKLLSEASELQYCDVDTKLLS 170 Score = 27.5 bits (58), Expect = 9.9 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 1/61 (1%) Frame = +2 Query: 161 EYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCE-DTRLSSSSGMAVLLTIQVVVKLM 337 +Y TKL EES ++ VD + +E C+ DT+L S + L V +KL+ Sbjct: 64 QYCDVDTKLLSEESELQYCDVDIKLLSEESELQYCDVDTKLLSEE--SELQYCDVDIKLL 121 Query: 338 T 340 + Sbjct: 122 S 122 >SB_25578| Best HMM Match : ShTK (HMM E-Value=2.4e-06) Length = 257 Score = 27.9 bits (59), Expect = 7.5 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +2 Query: 101 EYILVEFYAPWCGHCKSLAPEYAKAAT 181 +YI+ +F CG CK+LAP ++ T Sbjct: 123 KYIMKKFCQKECGLCKALAPPICQSTT 149 >SB_24641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1120 Score = 27.9 bits (59), Expect = 7.5 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 1/57 (1%) Frame = +2 Query: 143 CKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCEDTR-LSSSSGMAVLL 310 C+SLA E A KLA E + L +++ T Q A E TR + G+ +L+ Sbjct: 39 CRSLAGESASELKKLAAENQNLHLLELEVTDFQ--AIQRCAEQTREIVQDKGLHILM 93 >SB_34111| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 757 Score = 27.9 bits (59), Expect = 7.5 Identities = 10/33 (30%), Positives = 23/33 (69%) Frame = +3 Query: 537 KVIKELEAEDEDVVLFKNFEEKRVKYEDEESLR 635 +++ E+ E++D V+F+ E++ V ED+E ++ Sbjct: 99 QIMNEVGEEEDDDVIFEEAEKEEVGVEDKEEVK 131 >SB_32754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5659 Score = 27.9 bits (59), Expect = 7.5 Identities = 16/56 (28%), Positives = 27/56 (48%) Frame = +2 Query: 149 SLAPEYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCEDTRLSSSSGMAVLLTI 316 ++APE A+ ES ++L A++ ETT+ T L + MA+ T+ Sbjct: 1490 TMAPESTVASVTTMAPESTLELETTTASETTVAPETTMVPGTTLEPETTMALESTV 1545 >SB_55587| Best HMM Match : Merozoite_SPAM (HMM E-Value=0.13) Length = 359 Score = 27.5 bits (58), Expect = 9.9 Identities = 16/30 (53%), Positives = 20/30 (66%) Frame = +3 Query: 537 KVIKELEAEDEDVVLFKNFEEKRVKYEDEE 626 +V KELEAE E L K EE+R++ E EE Sbjct: 237 EVQKELEAEMEMERLQKENEEERLRKEKEE 266 >SB_41245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/33 (30%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +3 Query: 414 YRCQYCYCIWFLF-GPELNQSQNFPFNCSSC*C 509 Y C C C+W + + F + CS+C C Sbjct: 71 YGCSTCVCLWVQYRSLSMGAVPVFVYGCSTCLC 103 >SB_24643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 436 Score = 27.5 bits (58), Expect = 9.9 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 1/57 (1%) Frame = +2 Query: 143 CKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCEDTR-LSSSSGMAVLL 310 C+SLA E A KLA E + L +++ T Q A E TR + G+ +L+ Sbjct: 39 CRSLAGESASELKKLAAENQNLHLLELEVTDFQ--AIQRCAEQTREIVQEKGLHILV 93 >SB_4085| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 161 EYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCE-DTRLSS 286 +Y TKL EES ++ VD + +E C+ DT+L S Sbjct: 242 QYCDVDTKLLSEESELQYCDVDTKLLSEESELQYCDVDTKLLS 284 >SB_1402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 417 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 161 EYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCE-DTRLSS 286 +Y TKL EES ++ VD + +E C+ DT+L S Sbjct: 305 QYCDVDTKLLSEESELQYCDVDIKLVSEESELQYCDVDTKLLS 347 >SB_27739| Best HMM Match : DUF402 (HMM E-Value=9.2) Length = 288 Score = 27.5 bits (58), Expect = 9.9 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Frame = +2 Query: 161 EYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCE-DTR-LSSSSGM 298 +Y TKL EES ++ VD + +E C+ DT+ LS SG+ Sbjct: 16 QYCDVDTKLLWEESEVQYCDVDTKLLSEESELQYCDVDTKLLSEESGI 63 Score = 27.5 bits (58), Expect = 9.9 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 1/61 (1%) Frame = +2 Query: 161 EYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCE-DTRLSSSSGMAVLLTIQVVVKLM 337 +Y TKL EES ++ VD + +E C+ DT+L S + L V +KL+ Sbjct: 208 QYCDVDTKLLSEESELQYCDVDIKLLSEESELQYCDVDTKLLSEE--SELQYCDVDIKLL 265 Query: 338 T 340 + Sbjct: 266 S 266 >SB_17207| Best HMM Match : DB (HMM E-Value=5.1) Length = 184 Score = 27.5 bits (58), Expect = 9.9 Identities = 19/63 (30%), Positives = 30/63 (47%), Gaps = 1/63 (1%) Frame = +2 Query: 161 EYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCE-DTRLSSSSGMAVLLTIQVVVKLM 337 +Y TKL EES ++ VD + +E C+ DT+L S L V +KL+ Sbjct: 16 QYCDVDTKLLSEESELQYCDVDIKLLSEESELQYCDVDTKLLSEE--CELQYCDVDIKLL 73 Query: 338 TSS 346 + + Sbjct: 74 SEA 76 >SB_943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 628 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 161 EYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCE-DTRLSS 286 +Y TKL EES ++ VD + +E C+ DT+L S Sbjct: 156 QYCDVDTKLLSEESELQYCDVDTKLLSEESELQYCDVDTKLLS 198 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 161 EYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCE-DTRLSS 286 +Y TKL EES ++ VD + +E C+ DT+L S Sbjct: 220 QYCDVDTKLLSEESELQYCDVDTKLLSEESELQYCDVDTKLLS 262 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 161 EYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCE-DTRLSS 286 +Y TKL EES ++ VD + +E C+ DT+L S Sbjct: 236 QYCDVDTKLLSEESELQYCDVDTKLLSEESELQYCDVDTKLLS 278 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 161 EYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCE-DTRLSS 286 +Y TKL EES ++ VD + +E C+ DT+L S Sbjct: 252 QYCDVDTKLLSEESELQYCDVDTKLLSEESELQYCDVDTKLLS 294 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 161 EYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCE-DTRLSS 286 +Y TKL EES ++ VD + +E C+ DT+L S Sbjct: 268 QYCDVDTKLLSEESELQYCDVDTKLLSEESELQYCDVDTKLLS 310 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 161 EYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCE-DTRLSS 286 +Y TKL EES ++ VD + +E C+ DT+L S Sbjct: 284 QYCDVDTKLLSEESELQYCDVDTKLLSEESELQYCDVDTKLLS 326 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 161 EYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCE-DTRLSS 286 +Y TKL EES ++ VD + +E C+ DT+L S Sbjct: 300 QYCDVDTKLLSEESELQYCDVDTKLLSEESELQYCDVDTKLLS 342 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 161 EYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCE-DTRLSS 286 +Y TKL EES ++ VD + +E C+ DT+L S Sbjct: 316 QYCDVDTKLLSEESELQYCDVDTKLLSEESELQYCDVDTKLLS 358 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 161 EYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCE-DTRLSS 286 +Y TKL EES ++ VD + +E C+ DT+L S Sbjct: 332 QYCDVDTKLLSEESELQYCDVDTKLLSEESELQYCDVDTKLLS 374 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 161 EYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCE-DTRLSS 286 +Y TKL EES ++ VD + +E C+ DT+L S Sbjct: 348 QYCDVDTKLLSEESELQYCDVDTKLLSEESELQYCDVDTKLLS 390 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 161 EYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCE-DTRLSS 286 +Y TKL EES ++ VD + +E C+ DT+L S Sbjct: 364 QYCDVDTKLLSEESELQYCDVDTKLLSEESELQYCDVDTKLLS 406 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 161 EYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCE-DTRLSS 286 +Y TKL EES ++ VD + +E C+ DT+L S Sbjct: 380 QYCDVDTKLLSEESELQYCDVDTKLLSEESELQYCDVDTKLLS 422 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 161 EYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCE-DTRLSS 286 +Y TKL EES ++ VD + +E C+ DT+L S Sbjct: 396 QYCDVDTKLLSEESELQYCDVDTKLLSEESELQYCDVDTKLLS 438 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 161 EYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCE-DTRLSS 286 +Y TKL EES ++ VD + +E C+ DT+L S Sbjct: 412 QYCDVDTKLLSEESELQYCDVDTKLLSEESELQYCDVDTKLLS 454 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 161 EYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCE-DTRLSS 286 +Y TKL EES ++ VD + +E C+ DT+L S Sbjct: 428 QYCDVDTKLLSEESELQYCDVDTKLLSEESELQYCDVDTKLLS 470 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 161 EYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCE-DTRLSS 286 +Y TKL EES ++ VD + +E C+ DT+L S Sbjct: 444 QYCDVDTKLLSEESELQYCDVDTKLLSEESELQYCDVDTKLLS 486 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 161 EYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCE-DTRLSS 286 +Y TKL EES ++ VD + +E C+ DT+L S Sbjct: 460 QYCDVDTKLLSEESELQYCDVDTKLLSEESELQYCDVDTKLLS 502 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 161 EYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCE-DTRLSS 286 +Y TKL EES ++ VD + +E C+ DT+L S Sbjct: 476 QYCDVDTKLLSEESELQYCDVDTKLLSEESELQYCDVDTKLLS 518 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +2 Query: 161 EYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCE-DTRLSS 286 +Y+ TKL EES ++ VD + +E C+ DT+L S Sbjct: 540 QYSDVDTKLLSEESGLQYCDVDTKLLSEESELQYCDVDTKLLS 582 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 161 EYAKAATKLAEEESPIKLAKVDATQEQDLAETTVCE-DTRLSS 286 +Y TKL EES ++ VD + +E C+ DT+L S Sbjct: 556 QYCDVDTKLLSEESELQYCDVDTKLLSEESELQYCDVDTKLLS 598 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,341,262 Number of Sequences: 59808 Number of extensions: 353490 Number of successful extensions: 1348 Number of sequences better than 10.0: 54 Number of HSP's better than 10.0 without gapping: 970 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1331 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1645141000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -