BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060771.seq (651 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein... 86 1e-18 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 3.6 >AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein 70 protein. Length = 78 Score = 85.8 bits (203), Expect = 1e-18 Identities = 40/47 (85%), Positives = 43/47 (91%) Frame = +2 Query: 509 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKXGTGERNV 649 YFNDSQRQATKDAG I+GLNV+RIINEPTAAA+AYGLDK GERNV Sbjct: 9 YFNDSQRQATKDAGAIAGLNVMRIINEPTAAALAYGLDKNLKGERNV 55 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 24.2 bits (50), Expect = 3.6 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = +3 Query: 66 NGKSTRSRNRSGYHVLLRWCLPAREGGDHR--QRPG 167 +GK RS + +++LL P REG H+ Q PG Sbjct: 1802 DGKYKRSYSYEPHNLLLSNLFPPREGFHHKAVQLPG 1837 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 744,385 Number of Sequences: 2352 Number of extensions: 17202 Number of successful extensions: 24 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64395870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -