BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060770.seq (640 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 23 2.1 AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory recept... 21 8.7 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 23.0 bits (47), Expect = 2.1 Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = -1 Query: 589 EVVAHSLADSDFHGQRSCCHERPTPFMC-PMSVF 491 + + H L D + C H +PT F C P +VF Sbjct: 481 DFMPHELCDKYYR----CVHGKPTEFACRPGTVF 510 >AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory receptor candidate 55 protein. Length = 402 Score = 21.0 bits (42), Expect = 8.7 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -3 Query: 548 PTVLLS*ATNAFHVSHERFLGALKLRLVH 462 P++L N FH+ E + + L+L+H Sbjct: 321 PSILHELRNNYFHMDLENNVQSYSLQLLH 349 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,580 Number of Sequences: 336 Number of extensions: 3366 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16501678 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -