BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060770.seq (640 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC4C3.05c |nuc1|rpa1|DNA-directed RNA polymerase I complex lar... 27 2.3 SPBC336.03 |efc25||exchange factor Cdc25p-like|Schizosaccharomyc... 26 5.3 SPCC16A11.06c |gpi10||pig-B|Schizosaccharomyces pombe|chr 3|||Ma... 25 7.0 SPAC926.09c |fas1||fatty acid synthase beta subunit Fas1|Schizos... 25 9.2 SPCC297.03 |ssp1||serine/threonine protein kinase Ssp1 |Schizosa... 25 9.2 SPAPB1A10.13 |||sequence orphan|Schizosaccharomyces pombe|chr 1|... 25 9.2 >SPBC4C3.05c |nuc1|rpa1|DNA-directed RNA polymerase I complex large subunit Nuc1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1689 Score = 27.1 bits (57), Expect = 2.3 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +2 Query: 266 SWRRYKILKQSHPVKRMIRGIGAETTSTYSQ 358 S + YK L Q + VK ++ + +ET S+Y++ Sbjct: 1082 SAKNYKSLIQKYKVKSVLSAVDSETASSYAK 1112 >SPBC336.03 |efc25||exchange factor Cdc25p-like|Schizosaccharomyces pombe|chr 2|||Manual Length = 987 Score = 25.8 bits (54), Expect = 5.3 Identities = 17/51 (33%), Positives = 25/51 (49%) Frame = -1 Query: 334 GPNASNHSLYRMRLF*NFISTPAILRELRTEPATRWFD*SFAPIPSSDDRF 182 GP +NHS + + T + LR P + + + F P+PSSDD F Sbjct: 160 GPVRTNHSSSLSNSSNSLLQTESSLR-----PNSSFVNSPFFPLPSSDDLF 205 >SPCC16A11.06c |gpi10||pig-B|Schizosaccharomyces pombe|chr 3|||Manual Length = 506 Score = 25.4 bits (53), Expect = 7.0 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -3 Query: 491 LGALKLRLVHPTAPVLLTKIG 429 +G +LR V+P +P+LLT G Sbjct: 323 IGHKELRFVYPISPILLTLAG 343 >SPAC926.09c |fas1||fatty acid synthase beta subunit Fas1|Schizosaccharomyces pombe|chr 1|||Manual Length = 2073 Score = 25.0 bits (52), Expect = 9.2 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +1 Query: 361 FKWVRTPAYSNDEAGDL 411 F ++ P YS D+AGDL Sbjct: 443 FSALKVPVYSTDDAGDL 459 >SPCC297.03 |ssp1||serine/threonine protein kinase Ssp1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 652 Score = 25.0 bits (52), Expect = 9.2 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -2 Query: 102 VPAFVLRARLHSLIGNETPRECENH 28 VP FV LH G++TP C H Sbjct: 622 VPGFVSSPNLHLAGGSDTPIYCIEH 646 >SPAPB1A10.13 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 529 Score = 25.0 bits (52), Expect = 9.2 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = -3 Query: 188 SICTSESLRSSIRVSPDFDLTRHSSPSFGSQHLCS 84 S TS S ++SI S + + HSSPSF + L S Sbjct: 460 SPATSPSNQASIHASFTKESSTHSSPSFTLESLFS 494 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,818,737 Number of Sequences: 5004 Number of extensions: 60447 Number of successful extensions: 124 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 122 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 124 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 285732116 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -