BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060770.seq (640 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19053| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_13467| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_7775| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_32500| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_24543| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_20448| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_5288| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_4968| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_3995| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_1350| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_59236| Best HMM Match : Attractin (HMM E-Value=8.2) 42 3e-04 SB_53668| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_53194| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_47973| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_40285| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_16426| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_15603| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_19187| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_161| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_11440| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_40592| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) 36 0.028 SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) 32 0.45 SB_36629| Best HMM Match : Fer2 (HMM E-Value=0.0041) 30 1.4 SB_53289| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 29 3.2 SB_6844| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_50648| Best HMM Match : Atrophin-1 (HMM E-Value=1.3) 28 5.6 SB_6393| Best HMM Match : 7tm_1 (HMM E-Value=2.1e-28) 27 9.7 >SB_19053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 48.4 bits (110), Expect = 5e-06 Identities = 24/42 (57%), Positives = 28/42 (66%) Frame = -2 Query: 483 LKTTFGSSHSASSAYQNWPTWHRHQISGFIVRVSRSSHPFKV 358 L FGSS ASSAYQ WPT + H +SGF SR+S+ FKV Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGFNY-ASRTSYQFKV 57 >SB_13467| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 38 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -1 Query: 172 NRYGPPSGFPLTST*PGIVHHLSGPSICA 86 NRY PP FPL S GIVHHLSGP+ CA Sbjct: 1 NRYEPPPEFPLASPYSGIVHHLSGPNRCA 29 >SB_7775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 42.7 bits (96), Expect = 2e-04 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = -3 Query: 173 ESLRSSIRVSPDFDLTRHSSPSFGSQHLCS 84 ESLR+S RVS F L RHSSPSFGSQ + S Sbjct: 35 ESLRASTRVSSGFTLFRHSSPSFGSQQMRS 64 >SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 42.3 bits (95), Expect = 3e-04 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 483 LKTTFGSSHSASSAYQNWPTWHRHQISGF 397 L FGSS ASSAYQ WPT + H +SGF Sbjct: 57 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 85 >SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 42.3 bits (95), Expect = 3e-04 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 483 LKTTFGSSHSASSAYQNWPTWHRHQISGF 397 L FGSS ASSAYQ WPT + H +SGF Sbjct: 54 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 82 >SB_32500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 42.3 bits (95), Expect = 3e-04 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 483 LKTTFGSSHSASSAYQNWPTWHRHQISGF 397 L FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_24543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 42.3 bits (95), Expect = 3e-04 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 483 LKTTFGSSHSASSAYQNWPTWHRHQISGF 397 L FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_20448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 42.3 bits (95), Expect = 3e-04 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 483 LKTTFGSSHSASSAYQNWPTWHRHQISGF 397 L FGSS ASSAYQ WPT + H +SGF Sbjct: 55 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 83 >SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 42.3 bits (95), Expect = 3e-04 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 483 LKTTFGSSHSASSAYQNWPTWHRHQISGF 397 L FGSS ASSAYQ WPT + H +SGF Sbjct: 55 LNRAFGSSRIASSAYQKWPTSNSHSLSGF 83 >SB_5288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 42.3 bits (95), Expect = 3e-04 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 483 LKTTFGSSHSASSAYQNWPTWHRHQISGF 397 L FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_4968| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 42.3 bits (95), Expect = 3e-04 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 483 LKTTFGSSHSASSAYQNWPTWHRHQISGF 397 L FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_3995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 42.3 bits (95), Expect = 3e-04 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 483 LKTTFGSSHSASSAYQNWPTWHRHQISGF 397 L FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTKNSHSLSGF 45 >SB_1350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 42.3 bits (95), Expect = 3e-04 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 483 LKTTFGSSHSASSAYQNWPTWHRHQISGF 397 L FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_59236| Best HMM Match : Attractin (HMM E-Value=8.2) Length = 125 Score = 42.3 bits (95), Expect = 3e-04 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 483 LKTTFGSSHSASSAYQNWPTWHRHQISGF 397 L FGSS ASSAYQ WPT + H +SGF Sbjct: 96 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 124 >SB_53668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 42.3 bits (95), Expect = 3e-04 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 483 LKTTFGSSHSASSAYQNWPTWHRHQISGF 397 L FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_53194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 42.3 bits (95), Expect = 3e-04 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 483 LKTTFGSSHSASSAYQNWPTWHRHQISGF 397 L FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_47973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 42.3 bits (95), Expect = 3e-04 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 483 LKTTFGSSHSASSAYQNWPTWHRHQISGF 397 L FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_40285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 42.3 bits (95), Expect = 3e-04 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 483 LKTTFGSSHSASSAYQNWPTWHRHQISGF 397 L FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_16426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 42.3 bits (95), Expect = 3e-04 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 483 LKTTFGSSHSASSAYQNWPTWHRHQISGF 397 L FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_15603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 42.3 bits (95), Expect = 3e-04 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 483 LKTTFGSSHSASSAYQNWPTWHRHQISGF 397 L FGSS ASSAYQ WPT + H +SGF Sbjct: 139 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 167 >SB_19187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 41.9 bits (94), Expect = 4e-04 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 483 LKTTFGSSHSASSAYQNWPTWHRHQISGF 397 L FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNHAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = -2 Query: 483 LKTTFGSSHSASSAYQNWPTWHRHQISGF 397 L +GSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAYGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_11440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 39.9 bits (89), Expect = 0.002 Identities = 26/61 (42%), Positives = 30/61 (49%) Frame = -2 Query: 579 HTP*RIPTSMANGPAVMSDQRLSCVP*AFFRRLKTTFGSSHSASSAYQNWPTWHRHQISG 400 H P + P S P V SD+R L FGSS ASSA Q WPT + H +SG Sbjct: 50 HAP-QAPRSEQPTPFVGSDERR-------LWHLNRAFGSSRIASSALQKWPTRNSHSLSG 101 Query: 399 F 397 F Sbjct: 102 F 102 >SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 39.1 bits (87), Expect = 0.003 Identities = 20/47 (42%), Positives = 25/47 (53%) Frame = +1 Query: 481 KAPKKRSWDT*KALVAHDSRTVGHGSRNPLRSVQRLHLPKQPALKMD 621 + +RS D K + + GHGS NP + HLPKQ ALKMD Sbjct: 10 RCQSRRSSDPTKGVGCSRQQDGGHGSWNPAKECVTTHLPKQLALKMD 56 >SB_40592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 37.1 bits (82), Expect = 0.012 Identities = 17/29 (58%), Positives = 19/29 (65%) Frame = -2 Query: 483 LKTTFGSSHSASSAYQNWPTWHRHQISGF 397 L FGSS ASSAYQ PT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKGPTRNSHSLSGF 45 >SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 37.1 bits (82), Expect = 0.012 Identities = 20/47 (42%), Positives = 25/47 (53%) Frame = +1 Query: 481 KAPKKRSWDT*KALVAHDSRTVGHGSRNPLRSVQRLHLPKQPALKMD 621 + +RS D K + + GHGS NPL+ LPKQ ALKMD Sbjct: 10 RCQSRRSSDPTKGVGCSRQQDGGHGSWNPLKECVTTPLPKQLALKMD 56 >SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) Length = 212 Score = 35.9 bits (79), Expect = 0.028 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 543 RWPWKSESAKECATT 587 RWPWK ESAKEC TT Sbjct: 4 RWPWKLESAKECVTT 18 >SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 35.9 bits (79), Expect = 0.028 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 543 RWPWKSESAKECATT 587 RWPWK ESAKEC TT Sbjct: 4 RWPWKLESAKECVTT 18 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 35.9 bits (79), Expect = 0.028 Identities = 15/26 (57%), Positives = 17/26 (65%) Frame = -2 Query: 483 LKTTFGSSHSASSAYQNWPTWHRHQI 406 L FGSS ASSAYQ WPT + H + Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSL 42 >SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 35.9 bits (79), Expect = 0.028 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 543 RWPWKSESAKECATT 587 RWPWK ESAKEC TT Sbjct: 83 RWPWKLESAKECVTT 97 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 33.1 bits (72), Expect = 0.20 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -1 Query: 172 NRYGPPSGFPLTST*PGIVHH 110 NRY PP FPL S GIVHH Sbjct: 1 NRYEPPPEFPLASPYSGIVHH 21 >SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.20 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -2 Query: 483 LKTTFGSSHSASSAYQNWPT 424 L FGSS ASSAYQ WPT Sbjct: 17 LNRAFGSSRIASSAYQKWPT 36 >SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 32.7 bits (71), Expect = 0.26 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 222 ISLSPLYPVPTIDLHVR 172 ISLSPLYP TIDLHVR Sbjct: 38 ISLSPLYPNLTIDLHVR 54 >SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) Length = 276 Score = 31.9 bits (69), Expect = 0.45 Identities = 26/61 (42%), Positives = 29/61 (47%) Frame = -2 Query: 579 HTP*RIPTSMANGPAVMSDQRLSCVP*AFFRRLKTTFGSSHSASSAYQNWPTWHRHQISG 400 H P + P S P V SD+R P +R FGSS ASS YQN PT R G Sbjct: 50 HAP-QAPRSEQPTPFVGSDERRLWHP---YR----AFGSSRIASSGYQNGPTRTRIHCPG 101 Query: 399 F 397 F Sbjct: 102 F 102 Score = 28.3 bits (60), Expect = 5.6 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 7/56 (12%) Frame = -3 Query: 494 FLGALKLRLVHPTAPVLLTKI-------GPLGTVIRSPASSFE*AGVLTHLKFENR 348 F+G+ + RL HP ++I GP T I P + + G+LT+LKFENR Sbjct: 63 FVGSDERRLWHPYRAFGSSRIASSGYQNGPTRTRIHCPGFNKQ-VGLLTNLKFENR 117 >SB_36629| Best HMM Match : Fer2 (HMM E-Value=0.0041) Length = 128 Score = 30.3 bits (65), Expect = 1.4 Identities = 16/54 (29%), Positives = 33/54 (61%), Gaps = 4/54 (7%) Frame = +1 Query: 40 LPRRLVSNQ*MKARSEHKC----WDPKDGELCLVRSKSGETLMEDRSDSDVQID 189 L RR VSN + +++H+ + +DG+ V++K G++L++ D+DV ++ Sbjct: 29 LARRYVSNGKEQTKAKHETVSITFVDRDGDRQTVKAKVGDSLLDVAKDNDVDLE 82 >SB_53289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 29.5 bits (63), Expect = 2.4 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +1 Query: 547 GHGSRNPLRSVQRLHLPKQPALKMD 621 GHG + HLPKQ ALKMD Sbjct: 6 GHGKLESAKECVTTHLPKQLALKMD 30 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 29.1 bits (62), Expect = 3.2 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 3/43 (6%) Frame = +1 Query: 481 KAPKKRSWDT*KALVAHDSRTVGHGSRNPLRSVQRL---HLPK 600 + +RS D K + + GHGS NPLR QRL H P+ Sbjct: 10 RCQSRRSSDPTKGVGCSRQQDGGHGSWNPLRKGQRLENSHFPE 52 >SB_6844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 28.3 bits (60), Expect = 5.6 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -2 Query: 483 LKTTFGSSHSASSAYQNWP 427 L FGSS ASSAYQN P Sbjct: 17 LNRAFGSSRIASSAYQNGP 35 >SB_50648| Best HMM Match : Atrophin-1 (HMM E-Value=1.3) Length = 1281 Score = 28.3 bits (60), Expect = 5.6 Identities = 20/62 (32%), Positives = 29/62 (46%), Gaps = 1/62 (1%) Frame = -2 Query: 546 NGPAVMSDQRLSCVP*AFFRRLKTTFGSSHSASSAYQNWPTWHRHQISGFIVR-VSRSSH 370 N V + + L P AFF K T G +HS S ++N Q VR +++S+ Sbjct: 118 NMECVSNPRILPPKPSAFFTNGKRTQGPNHSPKSQWRNMRVMVNEQTLRLAVRHLNQSAS 177 Query: 369 PF 364 PF Sbjct: 178 PF 179 >SB_6393| Best HMM Match : 7tm_1 (HMM E-Value=2.1e-28) Length = 307 Score = 27.5 bits (58), Expect = 9.7 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = -1 Query: 118 VHHLSGPSICAQSAPSFTDWKRDASGVRKSR 26 V L+ S+C Q APSF + K+ AS VR ++ Sbjct: 183 VRKLAKISLCDQYAPSFKEKKKMASEVRVAK 213 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,410,370 Number of Sequences: 59808 Number of extensions: 472003 Number of successful extensions: 1121 Number of sequences better than 10.0: 40 Number of HSP's better than 10.0 without gapping: 988 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1119 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1608851125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -