BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060770.seq (640 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 25 1.5 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 25 2.7 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 25.4 bits (53), Expect = 1.5 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 5/55 (9%) Frame = +3 Query: 6 RELSSYVRD----FRTPEASRFQSVNEGAL*AQMLGPERW*TM-PGQVEVRGNPD 155 R + SY +D + T E +SV G +LGP W TM G +++ PD Sbjct: 598 RIIHSYFQDRELVYETSEGPVVRSVTAGVPQGSILGPTLWNTMYDGVLDIALPPD 652 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 24.6 bits (51), Expect = 2.7 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = +2 Query: 500 HGTHERRWSLMTAGPLAMEVGIR*GVCNDFTCRSNQP 610 HG H+RR M P + I G +T R++ P Sbjct: 381 HGLHQRRTPYMDGVPHVSQCPISPGTTFRYTFRADNP 417 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 714,138 Number of Sequences: 2352 Number of extensions: 15341 Number of successful extensions: 69 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 68 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 69 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62723250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -